Antibody

Ab1-ascl1

Antibody ID
ZDB-ATB-130128-1
Antibody Name
Ab1-ascl1
Previous Names
  • HPA029217 (1)
  • Anti-ASCL1 antibody produced in rabbit (1)
Host Organism
Rabbit
Immunogen Organism
Human
Isotype
Type
polyclonal
Assays
  • IHC
Antigen Genes
Antibody Registry ID
None
Source
Sigma-Aldrich
Note
Immunogen was 156–238 of human ASCL1 (sequence: MSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNY\nSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF).
Notes
Comment Citation
Immunogen was 156–238 of human ASCL1 (sequence:  ... ZFIN Curated Data
Anatomical Labeling
Antibody Labeling Summary
Citations