OBO ID: CHEBI:84736
Term Name: QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 Search Ontology:
Synonyms:
  • Ara-h2 peptide fragment
  • Glu-Ser-Pro-Ser-Tyr-Pro-Asp-Arg-Glu-Tyr-Ser-Asp-Glu-Asp-Arg-Gln-Ile-Lys-Gln-Met-Leu-His-Gln-Glu-Cys-Pro-Arg-Leu-NH2
  • H2N-QSPSYPDREYSDEDRQIKQMLHQECPRL-CONH2
  • L-glutaminyl-L-seryl-L-prolyl-L-seryl-L-tyrosyl-L-prolyl-L-alpha-aspartyl-L-arginyl-L-alpha-glutamyl-L-tyrosyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-alpha-aspartyl-L-arginyl-L-glutaminyl-L-isoleucyl-L-lysyl-L-glutaminyl-L-methionyl-L-leucyl-L-histid
Definition: A synthetic 28-amino acid polypeptide consisting of glutaminyl, seryl, prolyl, seryl, tyrosyl, prolyl, alpha-aspartyl, arginyl, alpha-glutamyl, tyrosyl, seryl, alpha-aspartyl, alpha-glutamyl, alpha-aspartyl, arginyl, glutaminyl, isoleucyl, lysyl, glutaminyl, methionyl, leucyl, histidyl, glutaminyl, alpha-glutamyl, cysteinyl, prolyl, arginyl and leucinamide residues joined in sequence. A synthetic version of the peptide epitope from the major peanut allergen glycoprotein Arachis hypogaea h2 (Ara-h2).
References:
Ontology: Chebi
PHENOTYPE No data available