OBO ID: CHEBI:80330
Term Name: peptide YY Search Ontology:
Synonyms:
  • peptide tyrosine tyrosine
  • PYY (3-36)
  • PYY 3-36
  • PYY3-36
  • Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
  • YPIKPEAPGEDASPEELNYYASLRHYLNLVTRQRY-NH2
Definition: A 36-membered human gut polypeptide consisting of Tyr, Pro, Ile, Lys, Pro, Glu, Ala, Pro, Gly, Glu, Asp, Ala, Ser, Pro, Glu, Glu, Leu, Asn, Arg, Tyr, Tyr, Ala, Ser, Leu, Arg, His, Tyr, Leu, Asn, Leu, Val, Thr, Arg, Gln, Arg and Tyr-NH2 residues joined in sequence.
References:
Ontology: Chebi
PHENOTYPE No data available