OBO ID: CHEBI:65312
Term Name: corticotropin-releasing hormone (human) Search Ontology:
Synonyms:
  • Corticoliberin
  • Corticotropin releasing hormone
  • corticotropin-releasing factor (human)
  • corticotropin-releasing factor (human/rat)
  • CRH
  • human/rat CRF
  • L-seryl-L-alpha-glutamyl-L-alpha-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-alpha-aspartyl-L-leucyl-L-valyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-alpha-glutamyl-L-valyl-L-leucyl-L-alpha-glutamyl-L-methionyl-L-alanyl-L-argi
  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
  • Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Definition: A corticotropin-releasing hormone from human/rat composed of Ser, Glu, Glu, Pro, Pro, Ile, Ser, Leu, Asp, Leu, Val, Phe, His, Leu, Leu, Arg, Glu, Val, Leu, Glu, Met, Ala, Arg, Ala, Glu, Gln, Leu, Ala, Gln, Gln, Ala, His, Ser, Asn, Arg, Lys, Leu, Met, Glu, Ile and Ile-NH2 residues joined in sequence.
References:
Ontology: Chebi
PHENOTYPE No data available