Community Action Needed: Please respond to the NIH RFI
Antibody

Ab1-ubr3

Antibody ID
ZDB-ATB-160802-1
Antibody Name
Ab1-ubr3
Previous Names
  • Anti-UBR3 antibody produced in rabbit (1)
  • HPA035390 (1)
Host Organism
Rabbit
Immunogen Organism
Human
Isotype
Type
polyclonal
Assays
  • IHC
Antigen Genes
Antibody Registry ID
AB_10670699
Source
Sigma-Aldrich
Note
Immunogen was human UBR3 DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE.
Notes
Comment Citation
Immunogen was human UBR3  ... ZFIN Curated Data
Anatomical Labeling
Antibody Labeling Summary
Citations