Antibody

Ab5-tubb

Antibody ID
ZDB-ATB-140317-2
Antibody Name
Ab5-tubb
Previous Names
  • Anti-TUBB antibody produced in rabbit (1)
  • SAB2102604 (1)
Host Organism
Rabbit
Immunogen Organism
Human
Isotype
Type
polyclonal
Assays
Antigen Genes
Antibody Registry ID
AB_10605874
Source
Sigma-Aldrich
Wiki
Note
None
Notes
Comment Citation
Immunogen sequence was "YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF",  ... Tapanes-Castillo et al., 2014
Anatomical Labeling
No data available
Citations