ZFIN ID: ZDB-ATB-140317-2
Antibody Name: Ab5-tubb
Synonyms: Anti-TUBB antibody produced in rabbit (1), SAB2102604 (1)

Add new Alias

Alias
Attribution

Attributions for Alias: {{control.newAlias}}

{{pub.zdbID}}

Delete Alias:

(Including Attributions)
Host Organism: Rabbit
Immunogen Organism: Human
Isotype:
Type: polyclonal
Assays:
Antigen Genes:
Source: Sigma-Aldrich
Wiki:
NOTES
Comment Citation
Immunogen sequence was "YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF",  ... Tapanes-Castillo et al., 2014
ANATOMICAL LABELING
CITATIONS (1)