Antibody

ab3-fabp7

Antibody ID
ZDB-ATB-101122-1
Antibody Name
Ab3-fabp7
Previous Names
  • ab27171 (1)
  • Anti-human BLBP (1)
Host Organism
Rabbit
Immunogen Organism
Human
Isotype
Type
polyclonal
Assays
  • IHC
Antigen Genes
Antibody Registry ID
AB_869739
Source
Abcam plc
Wiki
Note
None
Notes
Comment Citation
The immunogen is a synthetic peptide ( NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTL  ... ZFIN Curated Data
Anatomical Labeling
Citations