ZFIN ID: ZDB-ATB-101122-1
Antibody Name: Ab3-fabp7
Synonyms: ab27171 (1), Anti-human BLBP (1)

Add new Alias

Alias
Attribution

Attributions for Alias: {{control.newAlias}}

{{pub.zdbID}}

Delete Alias:

(Including Attributions)
Host Organism: Rabbit
Immunogen Organism: Human
Isotype:
Type: polyclonal
Assays: Immunohistochemistry
Antigen Genes:
Source: Abcam plc
Wiki:
NOTES
Comment Citation
The immunogen is a synthetic peptide ( NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTL  ... ZFIN Curated Data
ANATOMICAL LABELING
Anatomy Stage Assay Gene Data
caudal tuberculum Days 21-29 IHC Fig. 6  from  Grupp et al., 2010
ciliary marginal zone Adult IHC Fig. 4 with image  from  Solin et al., 2014
Muller cell Adult IHC Fig. 2 with image  from  Nagashima et al., 2013
optic tectum proliferative region Days 21-29 IHC Fig. 6  from  Grupp et al., 2010
tegmentum Days 21-29 IHC Fig. 6  from  Grupp et al., 2010
telencephalon proliferative region Days 21-29 IHC Fig. 6  from  Grupp et al., 2010
ventricular zone Days 21-29 IHC Fig. 6  from  Grupp et al., 2010
CITATIONS (10)