header logo image header logo text
Downloads Login
Research
General Information
ZIRC
ZFIN ID: ZDB-ATB-101122-1
Antibody Name: Ab3-fabp7
Synonyms: ab27171 (1), Anti-human BLBP (1)

Add new Alias

Alias
Attribution

Attributions for Alias: {{control.newAlias}}

{{pub.zdbID}}

Delete Alias:

(Including Attributions)
Host Organism: Rabbit
Immunogen Organism: Human
Isotype:
Type: polyclonal
Assays: Immunohistochemistry
Antigen Genes:
Antibody Registry ID: AB_869739
Source: Abcam plc
Wiki:
NOTES
Comment Citation
The immunogen is a synthetic peptide ( NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTL  ... ZFIN Curated Data
CITATIONS (10)