Search Ontology:
ChEBI
lixisenatide
- Term ID
- CHEBI:85662
- Synonyms
-
- Adlyxin
- AQVE-10010
- AVE 0010
- AVE0010
- des-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-L-lysyl-L-lysinamide
- DesPro38Exendin-4(1-39)-Lys6-NH2
- H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
- H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2
- H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu-L-Trp-L-Leu-L-Lys-L-Asn-Gly-Gly-L-Pro-L-Ser-L-Ser-Gly-L-Ala-L-Pro-L-Pro-L-Ser-L-Lys-L-Lys-L-Lys-L-Lys-L-Lys-L-Lys
- L-histidylglycyl-L-alpha-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L
- lixisenatida
- lixisenatide
- lixisenatidum
- Lyxumia
- ZP 10
- ZP10A peptide
- Definition
- A forty-four membered polypeptide consisting of L-His, Gly, L-Glu, Gly, L-Thr, L-Phe, L-Thr, L-Ser, L-Asp, L-Leu, L-Ser, L-Lys, L-Gln, L-Met, L-Glu, L-Glu, L-Glu, L-Ala, L-Val, L-Arg, L-Leu, L-Phe, L-Ile, L-Glu, L-Trp, L-Leu, L-Lys, L-Asn, Gly, Gly, LPro, L-Ser, L-Ser, Gly, L-Ala, L-Pro, L-Pro, L-Ser, L-Lys, L-Lys, L-Lys, L-Lys, L-Lys, and L-Lys-NH2 residues joined in sequence. Used as an adjunct to diet and exercise for the treatment of adults with type II diabetes.
- References
-
- CAS:320367-13-3
- Drug_Central:4815
- KEGG:D09729
- PMID:19629885
- PMID:21391833
- PMID:23537041
- PMID:23558600
- PMID:23825925
- PMID:23992745
- PMID:24086950
- PMID:24122776
- PMID:24363554
- PMID:24373190
- PMID:24476092
- PMID:24583037
- PMID:24641271
- PMID:24683832
- PMID:24876548
- PMID:25012990
- PMID:25027491
- PMID:25055456
- PMID:25066229
- PMID:25107586
- PMID:25115916
- PMID:25119443
- PMID:25130920
- PMID:25195184
- PMID:25773712
- PMID:25802728
- PMID:25853868
- PMID:25887358
- PMID:25965710
- PMID:26342556
- PMID:26423184
- PMID:26537183
- PMID:26594250
- PMID:26630143
- PMID:26701217
- PMID:26770666
- PMID:26787264
- PMID:26981945
- PMID:26981946
- PMID:26981947
- PMID:27092017
- PMID:27222510
- PMID:27252787
- PMID:27267268
- PMID:27284114
- PMID:27310712
- PMID:27311491
- PMID:27319011
- PMID:27341040
- Reaxys:23952540
- Wikipedia:Lixisenatide
- Ontology
- ChEBI ( EBI )
- is a type of
-
- has_role
-
Phenotype
Phenotype resulting from lixisenatide
Phenotype where environments contain lixisenatide
Phenotype modified by environments containing lixisenatide
Human Disease Model