Search Ontology:
ChEBI
exendin-3
- Term ID
- CHEBI:75469
- Synonyms
-
- Exendin 3
- His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
- HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
- L-histidyl-L-seryl-L-alpha-aspartylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl
- Definition
- A 39-membered polypeptide consisting of His, Ser, Asp, Gly, Thr, Phe, Thr, Ser, Asp, Leu, Ser, Lys, Gln, Met, Glu, Glu, Glu, Ala, Val, Arg, Leu, Phe, Ile, Glu, Trp, Leu, Lys, Asn, Gly, Gly, Pro, Ser, Ser, Gly, Ala, Pro, Pro, Pro and Ser-NH2 residues joined in sequence. It is isolated from venom of the Gila monster lizard Heloderma horridum.
- References
-
- CAS:130391-54-7
- KEGG:C15893
- PMID:1574068
- PMID:1700785
- PMID:1704369
- PMID:20111963
- PMID:22434628
- PMID:8393295
- Patent:WO2005120474
- Reaxys:14409601
- Reaxys:15550772
- Ontology
- ChEBI ( EBI )
- Resources
- CTD
Phenotype
Phenotype resulting from exendin-3
Phenotype where environments contain exendin-3
Phenotype modified by environments containing exendin-3
Phenotype affecting exendin-3
Human Disease Model