Search Ontology:
ChEBI
teduglutide
- Term ID
- CHEBI:72305
- Synonyms
-
- (Gly2)GLP-2
- ALX 0600
- ALX-0600
- Gattex
- Glucagon-like peptide II (2-glycine) (human)
- Gly(2)-GLP-2
- HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
- His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
- L-histidylglycyl-L-alpha-aspartylglycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparaginyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparaginyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-pheny
- teduglutide
- Definition
- A 33-membered polypeptide consisting of His, Gly, Asp, Gly, Ser, Phe, Ser, Asp, Glu, Met, Asn, Thr, Ile, Leu, Asp, Asn, Leu, Ala, Ala, Arg, Asp, Phe, Ile, Asn, Trp, Leu, Ile, Gln, Thr, Lys, Ile, Thr and Asp residues joined in sequence. A glucagon-like peptide-2 receptor agonist used for the treatment of short-bowel syndrome.
- References
-
- CAS:197922-42-2
- Drug_Central:4718
- KEGG:D06053
- PMID:19773525
- PMID:19821509
- PMID:19847163
- PMID:21153865
- PMID:21154171
- PMID:21317170
- PMID:21825090
- PMID:22016579
- PMID:22017694
- PMID:22224470
- PMID:22570676
- PMID:22951144
- PMID:22982184
- PMID:23059393
- PMID:23089542
- PMID:23187965
- PMID:23189208
- PMID:23331163
- PMID:23333663
- PMID:23343999
- Patent:US2006135424
- Patent:US2011172152
- Patent:WO2007065147
- Reaxys:15460110
- Wikipedia:Teduglutide
- Ontology
- ChEBI ( EBI )
- is a type of
-
- has_role
-
Show first 5 Terms
Phenotype
Phenotype resulting from teduglutide
Phenotype where environments contain teduglutide
Phenotype modified by environments containing teduglutide
Human Disease / Model Data