Search Ontology:
ChEBI
corticotropin-releasing hormone (ovine)
- Term ID
- CHEBI:65307
- Synonyms
-
- Corticotropin-releasing factor (sheep hypothalamus)
- Corticotropin-releasing factor (sheep)
- L-seryl-L-glutaminyl-L-alpha-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-alpha-aspartyl-L-leucyl-L-valyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-alpha-glutamyl-L-valyl-L-leucyl-L-alpha-glutamyl-L-methionyl-L-threonyl-L-lysyl-
- Ovine ACTH releasing factor
- Ovine corticotropin-releasing factor
- Ovine CRF 41
- Ovine CRH
- Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Val-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
- Sheep corticotropin-releasing factor (1-41)
- sheep corticotropin-releasing hormone
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
- Definition
- A corticotropin-releasing hormone from sheep composed of Ser, Gln, Glu, Pro, Pro, Ile, Ser, Leu, Asp, Leu, Val, Phe, His, Leu, Leu, Arg, Glu, Val, Leu, Glu, Met, Thr, Lys, Ala, Asp, Gln, Leu, Ala, Gln, Gln, Ala, His, Ser, Asn, Arg, Lys, Leu, Leu, Asp, Ile and Ala-NH2 residues joined in sequence.
- References
- Ontology
- ChEBI ( EBI )
- is a type of
-
- has_role
-
Phenotype
Phenotype resulting from corticotropin-releasing hormone (ovine)
Phenotype where environments contain corticotropin-releasing hormone (ovine)
Phenotype modified by environments containing corticotropin-releasing hormone (ovine)
Human Disease / Model Data
Citations