Antibody

Ab1-mcu

Antibody ID
ZDB-ATB-140604-3
Antibody Name
Ab1-mcu
Previous Names
  • Anti-CCDC109A (1)
  • Anti-MCU antibody produced in rabbit (1)
  • HPA016480 (1)
Host Organism
Rabbit
Immunogen Organism
Human
Isotype
Type
polyclonal
Assays
Antigen Genes
Antibody Registry ID
AB_2071893
Source
Sigma-Aldrich
Note
Imunogen was human mcu (CCDC109A)"HHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLV".
Notes
Comment Citation
Imunogen was human mcu  ... ZFIN Curated Data
Anatomical Labeling
Antibody Labeling Summary
Citations