Antibody

Ab3-oxt

Antibody ID
ZDB-ATB-140507-2
Antibody Name
Ab3-oxt
Previous Names
None
Host Organism
Rabbit
Immunogen Organism
Zebrafish
Isotype
Type
polyclonal
Assays
  • IHC
Antigen Genes
Antibody Registry ID
None
Source
Note
Immiunogen Partial recombinant protein, TLRCLEEDFLPSPCEMSGKACGYEGRCAAPGVCCDSEGCSVDQSCVDGDADAAAVNQPANSPDLLLKLLHLSSHTHPSRIHQ. Antibody verified using MO2-oxt.
Notes
Comment Citation
Immiunogen Partial recombinant protein,  ... Herget et al., 2014
Anatomical Labeling
Antibody Labeling Summary
Citations