

Antibody ID
Antibody Name
Previous Names
  • ab27171 (1)
  • Anti-human BLBP (1)
Host Organism
Immunogen Organism
  • IHC
Antigen Genes
Antibody Registry ID
Abcam plc
Comment Citation
The immunogen is a synthetic peptide ( NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTL  ... ZFIN Curated Data
Anatomical Labeling
Antibody Labeling Summary