Search Ontology:
ChEBI
corticotropin-releasing hormone (human)
- Term ID
- CHEBI:65312
- Synonyms
-
- Corticoliberin
- Corticotropin releasing hormone
- corticotropin-releasing factor (human)
- corticotropin-releasing factor (human/rat)
- CRH
- human/rat CRF
- L-seryl-L-alpha-glutamyl-L-alpha-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-alpha-aspartyl-L-leucyl-L-valyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-alpha-glutamyl-L-valyl-L-leucyl-L-alpha-glutamyl-L-methionyl-L-alanyl-L-argi
- SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
- Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
- Definition
- A corticotropin-releasing hormone from human/rat composed of Ser, Glu, Glu, Pro, Pro, Ile, Ser, Leu, Asp, Leu, Val, Phe, His, Leu, Leu, Arg, Glu, Val, Leu, Glu, Met, Ala, Arg, Ala, Glu, Gln, Leu, Ala, Gln, Gln, Ala, His, Ser, Asn, Arg, Lys, Leu, Met, Glu, Ile and Ile-NH2 residues joined in sequence.
- References
- Ontology
- ChEBI ( EBI )
Phenotype
Phenotype resulting from corticotropin-releasing hormone (human)
Phenotype where environments contain corticotropin-releasing hormone (human)
Phenotype modified by environments containing corticotropin-releasing hormone (human)
Phenotype affecting corticotropin-releasing hormone (human)
Human Disease Model