Term Name:	peptidyl amide
Synonyms:	peptidyl amides
Definition:	A peptide that has a carbamoyl group at the C-terminus.
Ontology:	ChEBI [CHEBI:15722] ( EBI )

Relationships

is a type of:	peptide
has subtype:	Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 corticotropin-releasing hormone (human) corticotropin-releasing hormone (ovine) dermaseptin s3(1-16)-NH2 gastrin-14 JNK inhibitor I kisspeptin-54 lixisenatide mastoparan mastoparan-A mastoparan-AF mastoparan-B mastoparan-D mastoparan-M mastoparan-V melittin omega-conotoxin GVIA peptide YY QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 tetragastrin
inverse is_conjugate_acid_of:	peptidylamide(1+)
is_conjugate_base_of:	peptidylamide(1+)