ZDB-ALT-020304-2 Df(Chr01)c1122 c1122, Df(LG01), Df(LG01)c1122 Deficiency Halpern Lab ZDB-LAB-980205-5 Chr: 1 2019-09-17
ZDB-ALT-991005-33 Df(Chr01:cx41.8,dla,msxb,otx1l)b220 b220, Df(LG01:cx41.8,dla,msxb,otx1l), Df(LG01:cx41.8,dla,msxb,otx1l)b220, Df(LG01)dla,leo,msxb,otx1l, Df(LG01)msxb, T(msxB) Deficiency sperm treated with g-rays Deletes the leo locus. Westerfield Lab ZDB-LAB-970408-1 Chr: 1 2019-09-17
ZDB-ALT-991005-43 Df(Chr01:cx41.8,msxb,otx1l)b776 dla ZDB-GENE-980526-29 b776, Df(LG01:cx41.8,msxb,otx1l), Df(LG01:cx41.8,msxb,otx1l)b776, Df(LG01)leo, Df(LG01)leo,msxb,otx1l, leog2 Deficiency g-rays Deletes the leo locus. Weston Lab ZDB-LAB-970408-87 Chr: 1 2019-09-17
ZDB-ALT-990423-12 Df(Chr01:hand2)s6 Df(Chr01:hand2)s6, s6 Deficiency adult males treated with ENU s6 deletion removes the entire hand2 gene; cannot rule out that the s6 mutation affects other genes Stainier Lab ZDB-LAB-970417-60 Chr: 1 2019-09-17
ZDB-ALT-070112-4 Df(Chr01:lef1,msxb)x8 Df(LG01:lef1,msxb)x8, Df(LG01:lef1)x8, Df(LG01:msxb), Df(LG01:msxb)x8, x8 Deficiency ENU Riley Lab ZDB-LAB-970908-94 Chr: 1 2019-09-17
ZDB-ALT-180521-8 Df(Chr01:timm10,rtn4rl2a,p2rx3b,pkd2,slc27a1b)ia2a cabp2a, slc43a3a ZDB-GENE-050913-25, ZDB-GENE-110208-8 Deficiency The authors established that the ia2 mutation was a deletion of 15.2 Mb spanning from marker chr1_450 at 43.69 Mb to the end of chromosome 1, represented by the telomeric microsatellite marker ZLG1Tel6035 at 58.88Mb. According with Genome Browser database (assembly GRCz10/danRer10), ia2 deletion involves 241 genes mapping in the telomeric region of chromosome 1.
IMPORTANT NOTE: Astone et al (2015) reported that the ia2 insertion, in Tg(-8.5nkx2.2a:GFP)^ia2 embryos, was associated with a deletion of 15.2 Mb in the telomeric portion of chromosome 1. The current ZFIN database structure is not designed to record this case of Transgenic Insertion associated with a Deficiency.
As a solution, the Transgenic Insertion and the Deficiency were recorded separately as ia2Tg (ZDB-ALT-070215-3) and ia2a (ZDB-ALT-180521-8), respectively, with an “is_allele” relationship to an imaginary gene “unm_ia2” (ZDB-GENE-180521-1). It must be noted the ia2 deletion (deficiency, ia2a) is apparently co-inherited with the ia2 transgene (ia2Tg).
For more details, please contact ZFIN. Argenton Lab ZDB-LAB-990226-9 Chr: 1 2019-09-17
ZDB-ALT-021021-2 Df(Chr02:csnk1g2a,rnf2,kifap3b)j6g1 cnn2 ZDB-GENE-030131-542 Df(Chr02:csnk1g2a,rnf2,kifap3)j6g1, Df(Chr2:csnk1g2a,rnf2,kifap3)j6g1, j6g1 Deficiency sperm treated with g-rays portion of Chr 2 is missing in j6g1 mutants Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 2 2019-09-17
ZDB-ALT-001129-10 Df(Chr03)c1015 c1015, Df(LG03), Df(LG03)c1015 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 3 2019-09-17
ZDB-ALT-000215-12 Df(Chr03)c1033 c1033, Df(LG03), Df(LG03)c1033 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 3 2019-09-17
ZDB-ALT-991201-5 Df(Chr03:elavl3,hoxb5a)b491 b491, Cr3(elavl3), Df(LG03)elavl3, Df(LG03:elavl3,hoxb5a), Df(LG03:elavl3,hoxb5a)b491 Deficiency g-rays Complex rearrangement. Westerfield Lab ZDB-LAB-970408-1 Chr: 3 2019-09-17
ZDB-ALT-001127-6 Df(Chr03:noxo1a,zgc:113100,sox8b,proza)cz26 sox9b ZDB-GENE-001103-2 ceylon, cz26, Df(Chr03:noxo1a,zgc:113100,sox8,proza)cz26 Deficiency adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Ambiguous 2019-09-17
ZDB-ALT-050322-2 Df(Chr03:sox8b,sox9b)b971 b971, Df(Chr03:sox8,sox9b)b971, Df(LG03:sox8,sox9b), Df(LG03:sox8,sox9b)b971, Df(LG03)sox9b Deficiency embryos treated with g-rays Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 3 2019-09-17
ZDB-ALT-030512-2 Df(Chr05:her1,her7,ndrg3a)b567 lhx3 ZDB-GENE-980526-131 b567, Df(LG05)her1, Df(LG05:her1,her7,ndrg3a), Df(LG05:her1,her7,ndrg3a)b567 Deficiency g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 5 2019-09-17
ZDB-ALT-991005-28 Df(Chr05:tnc)b345 epd, isl1, sox19a ZDB-GENE-980526-111, ZDB-GENE-980526-112, ZDB-GENE-980526-102 b345, Df(LG05)tenc, Df(LG05:tnc), Df(LG05:tnc)b345, Df(ten) Deficiency g-rays Deletion. Westerfield Lab ZDB-LAB-970408-1 Chr: 5 2019-09-17
ZDB-ALT-010125-6 Df(Chr06)c1046 c1046, Df(LG06), Df(LG06)c1046 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 6 2019-09-17
ZDB-ALT-991130-63 Df(Chr07)c1050 c1050, Df(LG07), Df(LG07)c1050 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 7 2019-09-17
ZDB-ALT-010426-4 Df(Chr07)t4 del, Df(Chr07)t4, DSHH, t4 Deficiency spontaneous Schauerte et al (1998)report that Southern analysis of t4 using genomic probes surrounding shh reveal that
this deletion extends beyond 4.0 kb 5' to the start codon and 2.2 kb 3' to the stop codon of the shh open reading frame. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 7 2019-09-17
ZDB-ALT-991201-10 Df(Chr07:ccne,eng2a,shha)b240 ascl1b ZDB-GENE-980526-174 b240, Cr7(ccne), Df(LG07)ccne, Df(LG07:ccne,eng2a,shha), Df(LG07:ccne,eng2a,shha)b240 Deficiency Complex rearrangement. Westerfield Lab ZDB-LAB-970408-1 Chr: 7 2019-09-17
ZDB-ALT-070306-1 Df(Chr07:stbm)vu7 Df(LG07:stbm)vu7, v7 Deficiency g-rays Lila Solnica-Krezel Lab - Vanderbilt University ZDB-LAB-981208-2 Chr: 7 2019-09-17
ZDB-ALT-010621-4 Df(Chr08)fs31l brpf1 ZDB-GENE-040426-731 Df(Chr08)fs31l, fs31, fs31l Deficiency adult males treated with ENU The Fishman Laboratory ZDB-LAB-970409-90 Chr: 8 2019-09-17
ZDB-ALT-001129-8 Df(Chr09)c1118 c1118, Df(LG09), Df(LG09)c1118 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 9 2019-09-17
ZDB-ALT-991201-20 Df(Chr10)c1014 c1014, Df(LG10), Df(LG10)c1014 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 10 2019-09-17
ZDB-ALT-980203-472 Df(Chr10:tdgf1)b173 b173, Df(Chr10:oep)b173, Df(LG10:oep), Df(LG10:oep)b173 Deficiency adult males treated with g-rays The b173 allele was originally identified as a translocation; however, after several generations this mutant allele began to segregate as a deletion with Mendelian frequency. Kimmel Lab ZDB-LAB-970408-13 Ambiguous 2019-09-17
ZDB-ALT-010426-14 Df(Chr10:tdgf1)st2 Df(Chr10:oep)st2, st2 Deficiency adult males treated with ENU st2 deletes the oep region of Chr 10; missing genes/markers:z7316, oep, BAC165D4, Z8146, Z13632 Talbot Lab ZDB-LAB-970505-34 Ambiguous 2019-09-17
ZDB-ALT-001214-2 Df(Chr10:tdgf1)z1 Df(Chr10:oep)z1, Df(Chr:oep)z1, z1 Deficiency g-rays Grunwald Lab ZDB-LAB-980205-1 Chr: 10 2019-09-17
ZDB-ALT-991201-31 Df(Chr11)c1020 c1020, Df(LG11), Df(LG11)c1020 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 11 2019-09-17
ZDB-ALT-050216-6 Df(Chr11:bmp7a)p11 Df(Chr11:bmp7a)p11, p11 Deficiency g-rays missing bmp7 as well as Z8214, Z13411 and Z6909 Mullins Laboratory ZDB-LAB-990119-1 Chr: 11 2019-09-17
ZDB-ALT-050216-4 Df(Chr11:bmp7a)p15 Df(Chr11:bmp7a)p15, p15 Deficiency g-rays missing bmp7 as well as Z8214, Z13411 and Z6909 Mullins Laboratory ZDB-LAB-990119-1 Chr: 11 2019-09-17
ZDB-ALT-001129-6 Df(Chr12)c1044 c1044, Df(LG12), Df(LG12)c1044 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 12 2019-09-17
ZDB-ALT-001129-4 Df(Chr12)c1098 c1098, Df(LG12), Df(LG12)c1098 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 12 2019-09-17
ZDB-ALT-180215-1 Df(Chr12:dlx3b, dlx4b)tud70 Deficiency embryos treated with CRISPR1-dlx3b, CRISPR1-dlx4b Brand Lab ZDB-LAB-970909-2 Chr: 12 2019-09-17
ZDB-ALT-030219-2 Df(Chr12:dlx3b,dlx4b,tbx6)b380 egr2b ZDB-GENE-980526-283 b380, Df(LG12)dlx3, Df(LG12)dlx3b, Df(LG12:dlx3b,dlx4b,tbx24), Df(LG12:dlx3b,dlx4b,tbx24)b380, Df(LG12:dlx3b,dlx4b,tbx6)b380 Deficiency g-rays Westerfield Lab ZDB-LAB-970408-1 Chr: 12 2019-09-17
ZDB-ALT-980203-605 Df(Chr12:hhex)b16 b16, Df(Chr12:hhex)b16 Deficiency embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 12 2019-09-17
ZDB-ALT-991201-26 Df(Chr12:ndr2)b229 b229, cyclops, Df(LG12)cyc, Df(LG12:ndr2), Df(LG12:ndr2)b229 Deficiency sperm treated with g-rays Deletion. Kimmel Lab ZDB-LAB-970408-13 Chr: 12 2019-09-17
ZDB-ALT-991201-38 Df(Chr12:ndr2)c34 c34, Df(LG12)cyc, Df(LG12:ndr2), Df(LG12:ndr2)c34 Deficiency g-rays Deletion. Westerfield Lab ZDB-LAB-970408-1 Chr: 12 2019-09-17
ZDB-ALT-991130-214 Df(Chr12:ndr2)c39 c39, Df(LG12)cyc, Df(LG12:ndr2), Df(LG12:ndr2)c39 Deficiency g-rays Deletion, non-Mendelian. Westerfield Lab ZDB-LAB-970408-1 Chr: 12 2019-09-17
ZDB-ALT-010426-8 Df(Chr12:ndr2)st5 Df(Chr12:ndr2)st5, st5 Deficiency ENU Talbot Lab ZDB-LAB-970505-34 Chr: 12 2019-09-17
ZDB-ALT-020306-2 Df(Chr13)c1090 c1090, Df(LG13), Df(LG13)c1090 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 13 2019-09-17
ZDB-ALT-010426-10 Df(Chr13)st4 vent, vox ZDB-GENE-010108-2, ZDB-GENE-010108-1 Df(LG13), Df(LG13)st4, st4 Deficiency ENU Talbot Lab ZDB-LAB-970505-34 Chr: 13 2019-09-17
ZDB-ALT-980203-381 Df(Chr13:lycat)m39 Df(Chr13:lycat)m39, m39 Deficiency spontaneous The Fishman Laboratory ZDB-LAB-970409-90 Chr: 13 2019-09-17
ZDB-ALT-991201-146 Df(Chr13:noto)b327 b327, Df(Chr13:flh)b327, Df(LG13:flh), Df(LG13:flh)b327 Deficiency g-rays Deletion. Halpern Lab ZDB-LAB-980205-5 Chr: 13 2019-09-17
ZDB-ALT-030812-2 Df(Chr13:vox,vent)st7 Df(LG13:vox,vent), Df(LG13:vox,vent)st7, st7 Deficiency adult males treated with ENU Unbalanced translocation, heterozygotes transmit deletion as Mendelian recessive lethal. Talbot Lab ZDB-LAB-970505-34 Chr: 13 2019-09-17
ZDB-ALT-030812-8 Df(Chr13:vox,vent)st8 Df(LG13:vox,vent), Df(LG13:vox,vent)st8, st8 Deficiency adult males treated with ENU Unbalanced translocation, heterozygotes transmit deletion as Mendelian recessive lethal. Talbot Lab ZDB-LAB-970505-34 Chr: 13 2019-09-17
ZDB-ALT-010426-12 Df(Chr14:gpc4)st3 Df(Chr14:gpc4)st3, st3 Deficiency ENU Stainier Lab ZDB-LAB-970417-60 Chr: 14 2019-09-17
ZDB-ALT-020130-2 Df(Chr14:wnt8a)w8 msx2a ZDB-GENE-980526-322 Df(LG14:wnt8a), Df(LG14:wnt8a)w8, Df(wnt8), w8 Deficiency g-rays Randall Moon Lab ZDB-LAB-970430-13 Chr: 14 2019-09-17
ZDB-ALT-991208-25 Df(Chr15)b409 b409, Df(Chr15)b409 Deficiency sperm treated with g-rays b409 is missing the 3'-UTR of the lhx1a1 gene, as well as z24 Halpern Lab ZDB-LAB-980205-5 Chr: 15 2019-09-17
ZDB-ALT-001023-2 Df(Chr15)c1083 c1083, Df(LG15), Df(LG15)c1083 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 15 2019-09-17
ZDB-ALT-001129-2 Df(Chr15)c1102 c1102, Df(LG15), Df(LG15)c1102 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 15 2019-09-17
ZDB-ALT-010125-8 Df(Chr15)c1130 c1130, Df(LG15), Df(LG15)c1130 Deficiency Halpern Lab ZDB-LAB-980205-5 Chr: 15 2019-09-17
ZDB-ALT-991208-30 Df(Chr15:chd)c4 c4, Df(LG15:chd), Df(LG15:chd)c4 Deficiency sperm treated with g-rays b305 b386 b409 c4 and c47 are overlapping deficiencies affecting the cerebum (crm) locus. Halpern Lab ZDB-LAB-980205-5 Chr: 15 2019-09-17
ZDB-ALT-991208-20 Df(Chr15:crm)c7 chrd, lhx1a ZDB-GENE-990415-33, ZDB-GENE-980526-347 c47, c7, Df(LG15:crm), Df(LG15:crm)c7 Deficiency adult males treated with g-rays b305, b386, b409 c4 and c47 are overlapping deficiencies affecting the cerebum (crm) locus. Chien Lab ZDB-LAB-981125-13 Chr: 15 2019-09-17
ZDB-ALT-030210-4 Df(Chr15:supt5h)s30 Df(LG15:supt5h), Df(LG15:supt5h)s30, s30 Deficiency Stainier Lab ZDB-LAB-970417-60 Ambiguous 2019-09-17
ZDB-ALT-010125-2 Df(Chr16)c1064 c1064, Df(LG16), Df(LG16)c1064 Deficiency Halpern Lab ZDB-LAB-980205-5 Chr: 16 2019-09-17
ZDB-ALT-000822-2 Df(Chr16)c1069 c1069, Df(LG16), Df(LG16)c1069 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 16 2019-09-17
ZDB-ALT-060125-2 Df(Chr16:fbxl4,coq3,pnrc2,pou3f1,rspo1,gnl2,dnali1,snip1)b644 mms22l ZDB-GENE-030131-3869 b644, tor, tortuga Deficiency ENU Deficiency maps to a 1.46 Mb region on Chromosome 16 spanning an interval of at least 20 known or predicted protein-coding RefSeq-annotated genes in genome assembly GRCz10/danRer10.
One breakpoint lies 0.30 cM to the left of the SSLP markers z13511, in a ~206 kb interval between mms22l and the intergenic region.
The other breakpoint lies 0.37 cM to the right of the SSLP markers z9511, in the ~2.9 kb genomic interval between exon 1 and intron 3 of snip1. Amacher Lab ZDB-LAB-001018-2 Ambiguous 2019-09-17
ZDB-ALT-980203-816 Df(Chr18)b13 b13, Df(Chr:18)b13 Deficiency embryos treated with g-rays Streisinger Lab ZDB-LAB-980209-8 Chr: 18 2019-09-17
ZDB-ALT-001115-2 Df(Chr19)c1017 c1017, Df(LG19), Df(LG19)c1017 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 19 2019-09-17
ZDB-ALT-991203-8 Df(Chr20)c1032 c1032, Df(LG20), Df(LG20)c1032 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 20 2019-09-17
ZDB-ALT-991206-7 Df(Chr20:kita)b465 b465, Df(LG20)kit, Df(LG20:kita), Df(LG20:kita)b465 Deficiency g-rays Weston Lab ZDB-LAB-970408-87 Chr: 20 2019-09-17
ZDB-ALT-000921-10 Df(Chr20:kita)j1g2 Df(LG20)kit, Df(LG20:kita), Df(LG20:kita)j1g2, j1g2 Deficiency g-rays Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-000822-6 Df(Chr22)c1096 c1096, Df(LG22), Df(LG22)c1096 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 22 2019-09-17
ZDB-ALT-000822-4 Df(Chr22)c1103 c1103, Df(LG22), Df(LG22)c1103 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 22 2019-09-17
ZDB-ALT-010125-4 Df(Chr22)c1104 c1104, Df(LG22), Df(LG22)c1104 Deficiency Halpern Lab ZDB-LAB-980205-5 Chr: 22 2019-09-17
ZDB-ALT-030409-2 Df(Chr23:acvr1ba,sp5l,wnt1,wnt10b)w5 zgc:153867 ZDB-GENE-030131-9170 Df(Chr23:acvr1b,sp5l,wnt1,wnt10b)w5, Df(LG23:acvr1b,sp5l,wnt1,wnt10b), Df(LG23:acvr1b,sp5l,wnt1,wnt10b)w5, w5 Deficiency embryos treated with g-rays Df(LG23)wnt1w5 is a deletion of the wnt1 and wnt10b loci. Randall Moon Lab ZDB-LAB-970430-13 Chr: 23 2019-09-17
ZDB-ALT-970731-8 Df(Chr23:mafb,snai1b)b361 tnnt2a ZDB-GENE-000626-1 b361, Df(LG23:mafb,snai1b), Df(LG23:mafb,snai1b)b361 Deficiency embryos treated with g-rays Deficiency (gamma-ray induced) also AC6.590(RAPD), I1.900 (RAPD). Mendelian. Kimmel Lab ZDB-LAB-970408-13 Chr: 23 2019-09-17
ZDB-ALT-970731-24 Df(Chr23:mafb,snai1b,tnnt2)b475 b475, Df(LG23:mafb,snai1b,tnnt2), Df(LG23:mafb,snai1b,tnnt2)b475 Deficiency embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 23 2019-09-17
ZDB-ALT-180822-2 Df(Chr23:mir200a,mir200b,mir429)hza53 Deficiency embryos treated with CRISPR1-CR9525720.9, CRISPR2-CR9525720.9 Jie Mei Lab ZDB-LAB-170210-3 Unmapped 2019-09-17
ZDB-ALT-991201-109 Df(Chr23:myb)b316 b316, Df(Chr23:cmyb)b316, T(LG23:hoxc5a,myb,pou6f1,rarg,wnt1)b316, T(LG23:hoxc5a,myb,pouc,rarg,wnt1), T(LG23:hoxc5a,myb,pouc,rarg,wnt1)b316, T(LG23)wnt1 Deficiency g-rays Thompson et al (1998) report that b316 is a gamma ray induced deletion of a large portion of chromosome 23. Westerfield Lab ZDB-LAB-970408-1 Chr: 23 2019-09-17
ZDB-ALT-991201-121 Df(Chr23:plod3)b531 b531, T(LG23)her4, T(LG23:her4,hoxc5a,pou6f1)b531, T(LG23:her4,hoxc5a,pouc), T(LG23:her4,hoxc5a,pouc)b531 Deficiency g-rays Zeller et al. (2002) report that b531 is a gamma ray induced allele in which the entire diwanka locus is deleted. Fritz Lab ZDB-LAB-000522-1 Ambiguous 2019-09-17
ZDB-ALT-991201-43 Df(Chr24)c1002 c1002, Df(LG24), Df(LG24)c1002 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 24 2019-09-17
ZDB-ALT-991201-48 Df(Chr24)c1018 c1018, Df(LG24), Df(LG24)c1018 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 24 2019-09-17
ZDB-ALT-991130-224 Df(Chr24)c1054 c1054, Df(LG24), Df(LG24)c1054 Deficiency sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 24 2019-09-17
ZDB-ALT-000405-2 Df(Chr24:reck)w15 Df(Chr24:reck)w15, w15 Deficiency adult males treated with ENU The w15 allele is a large deletion of chromosome 24 encompassing at least 0.4 Mb and including the entire sdp critical region. David Raible Lab ZDB-LAB-980202-1 Chr: 24 2019-09-17
ZDB-ALT-991201-54 Df(Chr25:ogo_b180)b180 b180, Df(LG25:ogo_b180), Df(LG25:ogo_b180)b180 Deficiency embryos treated with g-rays Miller-Bertoglio, et al (1999) demonstrate that the mercedes, short tail and ogon mutations are allelic and rename them all as ogon (ogo). Kimmel Lab ZDB-LAB-970408-13 Chr: 25 2019-09-17
ZDB-ALT-980203-391 Df(Chr25:szl)m60 Df(Chr25:ogo_m60, Df(Chr25:ogo_m60)m60, Df(LG25:ogo_m60), Df(LG25:ogo_m60)m60, m60 Deficiency spontaneous Miller-Bertoglio, et al (1999) demonstrate that the mercedes, short tail and ogon mutations are allelic and rename them all as ogon (ogo). The Fishman Laboratory ZDB-LAB-970409-90 Chr: 25 2019-09-17
ZDB-ALT-160707-2 Df(Chr2:mib1,foxc1a)nn2002 abi1b, ap2m1a ZDB-GENE-060929-1182, ZDB-GENE-030131-9784 nn2002 Deficiency adult males treated with ENU nn2002 mutants have a regional deletion in the genome, where part of chromosome 2, including mib1 and foxc1a, is deleted. Jiang Lab ZDB-LAB-020109-1 Ambiguous 2019-09-17
ZDB-ALT-180822-1 Df(Chr6:mir141,mir200c,mir429b)hza52 Deficiency embryos treated with CRISPR1-CU855953.4, CRISPR2-CU855953.4 Jie Mei Lab ZDB-LAB-170210-3 Unmapped 2019-09-17
ZDB-ALT-190404-19 Df(chr1:mir17a1,mir18a,mir19a,mir20a,mir19b,mir92a-1)zf2098 zf2098 Deficiency embryos treated with TALEN1-CABZ01079541, TALEN2-CABZ01079541 Multiple lines were created in which the entire multi-mir cluster called "mir17-92" was removed, but the author did not verify which line was maintained ZFIN Database Team ZDB-LAB-000914-1 Unmapped 2019-09-17
ZDB-ALT-190404-20 Df(chr4:mir430a-18,mir430b-17)zf2099 zf2099 Deficiency embryos treated with TALEN1-BX088538, TALEN2-BX088538 Multiple lines were created in which the entire multi-mir cluster called "mir430" was removed, but the author did not verify which line was maintained ZFIN Database Team ZDB-LAB-000914-1 Unmapped 2019-09-17
ZDB-ALT-991111-55 T(Chr01:dlx6a,eng1b)r1 r1, T(LG01)dlx6, T(LG01:dlx6a,eng1b), T(LG01:dlx6a,eng1b)r1 Translocation Balanced translocation with r3. Groupe Danio ZDB-LAB-970730-46 Ambiguous 2019-09-17
ZDB-ALT-991130-131 T(Chr03:eve1,hoxb5a,pyy,rarab,thra)b245 b245, T(hoxb), T(LG03:eve1,hoxb5a,pyy,rarab,thra), T(LG03:eve1,hoxb5a,pyy,rarab,thra)b245 Translocation g-rays Balanced translocation with b246. Non-Mendelian. Westerfield Lab ZDB-LAB-970408-1 Ambiguous 2019-09-17
ZDB-ALT-991201-131 T(Chr03:eve1,hoxb5a,pyy,rarab,thra)b447 b447, T(LG03:eve1,hoxb5a,pyy,rarab,thra), T(LG03:eve1,hoxb5a,pyy,rarab,thra)b447, T(LG03)hoxb Translocation g-rays Balanced translocation with b524. Westerfield Lab ZDB-LAB-970408-1 Ambiguous 2019-09-17
ZDB-ALT-991130-219 T(Chr09)r2 r2, T(LG09), T(LG09)r2 Translocation Balanced translocation. Groupe Danio ZDB-LAB-970730-46 Chr: 9 2019-09-17
ZDB-ALT-991201-136 T(Chr09:dlx1a,dlx2a,eng1a,hoxd4a)b566 b566, T(LG09:dlx1a,dlx2a,eng1a,hoxd4a), T(LG09:dlx1a,dlx2a,eng1a,hoxd4a)b566, T(LG09)eng1 Translocation Balanced translocation (?). Westerfield Lab ZDB-LAB-970408-1 Chr: 9 2019-09-17
ZDB-ALT-991201-59 T(Chr10)p4 p4, T(LG10), T(LG10)p4 Translocation Translocation. Halpern Lab ZDB-LAB-980205-5 Ambiguous 2019-09-17
ZDB-ALT-131017-1 T(Chr11)as10 Translocation adult males treated with ENU A 1kb+ sequence from chromosome 11 is inserted into intron 1 of s1pr2 on chormosome 3 Hwang Lab ZDB-LAB-970417-28 Chr: 3 2019-09-17
ZDB-ALT-991201-64 T(Chr12:ndr2)b213 b213, cyclops, T(LG12)cyc, T(LG12:ndr2), T(LG12:ndr2)b213 Translocation embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 12 2019-09-17
ZDB-ALT-991201-70 T(Chr12:ndr2)c106 c106, Df(LG12)cyc, T(LG12)cyc, T(LG12:ndr2), T(LG12:ndr2)c106 Translocation g-rays Balanced translocation with c108. Halpern Lab ZDB-LAB-980205-5 Chr: 12 2019-09-17
ZDB-ALT-991201-82 T(Chr13:noto)b277 b277, T(Chr13:flh)b277, T(LG13:flh), T(LG13:flh)b277 Translocation Balanced translocation with LG 12. Halpern Lab ZDB-LAB-980205-5 Chr: 13 2019-09-17
ZDB-ALT-991201-77 T(Chr13:noto)b325 b325, T(Chr13:flh)b325, T(LG13:flh), T(LG13:flh)b325 Translocation Balanced translocation with LG 12. Halpern Lab ZDB-LAB-980205-5 Chr: 13 2019-09-17
ZDB-ALT-991201-88 T(Chr14:msxa)c111 c111, T(LG14:msxa), T(LG14:msxa)c111 Translocation Balanced translocation with b386 Halpern Lab ZDB-LAB-980205-5 Chr: 14 2019-09-17
ZDB-ALT-020130-4 T(Chr14:wnt8a)w11 T(LG14)wnt8, T(LG14:wnt8a), T(LG14:wnt8a)w11, w11 Translocation sperm treated with ENU Randall Moon Lab ZDB-LAB-970430-13 Chr: 14 2019-09-17
ZDB-ALT-991201-93 T(Chr15:dharma)vu9 T(Chr15:dharma)v9, T(LG15)boz, T(LG15:dharma), T(LG15:dharma)v9, v9 Translocation adult males treated with g-rays Translocation (?). Halpern Lab ZDB-LAB-980205-5 Chr: 15 2019-09-17
ZDB-ALT-991201-104 T(Chr16:ctnnb)c46 c46, T(LG16:ctnnb), T(LG16:ctnnb)c46 Translocation Balanced translocation (?). Westerfield Lab ZDB-LAB-970408-1 Chr: 16 2019-09-17
ZDB-ALT-991201-98 T(Chr16:gdf6a)r3 r3, T(LG16:gdf6a), T(LG16:gdf6a)r3, T(LG16)radar Translocation Balanced translocation. Delot et al. (1999; ZDB-PUB-990728-2) state that a 27.4 cM region encompassing gdf6a is missing in the mutant, and that a breakpoint is 4 cM from the gdf6a gene. Groupe Danio ZDB-LAB-970730-46 Ambiguous 2019-09-17
ZDB-ALT-991201-141 T(Chr17:gdf3,gsc)b571 b571, T(Chr17:dvr1,gsc)b571, T(LG17:dvr1,gsc), T(LG17:dvr1,gsc)b571, T(LG17)gsc Translocation Balanced translocation. Westerfield Lab ZDB-LAB-970408-1 Chr: 17 2019-09-17
ZDB-ALT-991201-114 T(Chr17:gsc)b250 b250, T(LG17:gsc), T(LG17:gsc)b250 Translocation g-rays Terminal translocation. Westerfield Lab ZDB-LAB-970408-1 Chr: 17 2019-09-17
ZDB-ALT-991201-126 T(Chr25:foxb1a,isl2,myod)b349 b349, T(Chr25:foxb1.2,isl2,myod)b349, T(LG25:foxb1.2,isl2,myod), T(LG25:foxb1.2,isl2,myod)b349, T(LG25)myod Translocation Balanced translocation with c112. Halpern Lab ZDB-LAB-980205-5 Chr: 25 2019-09-17
ZDB-ALT-980203-769 a1 Point Mutation ENU The mutation in a splice acceptor site results in a two-amino-acid deletion (T138-K139) and a missense mutation (V140I). Dowling Lab ZDB-LAB-970501-1 Chr: 6 2019-09-17
ZDB-ALT-011017-4 a101 Unknown Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-980203-570 a12 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-180201-1 a12200Tg Transgenic Insertion embryos treated with DNA Engert Lab ZDB-LAB-070419-2 Unmapped Tg2(elavl3:GCaMP6f) ZDB-TGCONSTRCT-180201-2 2019-09-17
ZDB-ALT-050714-2 a125Tg a125, Tg(1.3Xops:XrhoCT44-GFP), Tg(1.3Xops:XrhoCT44-GFP)a125 Transgenic Insertion embryos treated with DNA Dowling Lab ZDB-LAB-970501-1 Unmapped Tg(1.3Xla.Ops:Xla.RhoCT44-GFP) ZDB-TGCONSTRCT-070117-132 2019-09-17
ZDB-ALT-110215-3 a126Tg Tg(hcrt-UAS-Xla.Eef1a:GFP-Aequorin)a126, Tg(hcrt-UAS-Xla.Eef1a:GFP-apoAquorin)a126 Transgenic Insertion embryos treated with DNA Engert Lab ZDB-LAB-070419-2 Unmapped Tg(hcrt-UAS-Xla.Eef1a1:GFP-Aequorin) ZDB-TGCONSTRCT-110208-3 2019-09-17
ZDB-ALT-110215-4 a127Tg Tg(UAS-Xla.Eef1a1-Xla.NBetatubb3:GFP-Aequorin)a127, Tg(UAS-Xla.Eef1a-Xla.NBetatubb3:GFP-Aequorin)a127, Tg(UAS-Xla.Eef1a-Xla.NBetatubb3:GFP-apoAequorin)a127 Transgenic Insertion embryos treated with DNA Engert Lab ZDB-LAB-070419-2 Unmapped Tg(UAS-Xla.Eef1a1-Xla.Tubb2b:GFP-Aequorin) ZDB-TGCONSTRCT-110215-2 2019-09-17
ZDB-ALT-120208-1 a128Tg Tg(isl1:Gal4-VP16,14xUAS:Kaede)a128 Transgenic Insertion embryos treated with DNA In a128, Kaede is expressed in a subset of trigeminal ganglion sensory neurons that preferentially express robo2. In the absence of robo2, these neurons exhibit increased axon branch growth and synaptogenesis at the hindbrain-spinal cord junction. Pan et al. (2012) Schier Lab ZDB-LAB-970505-58 Unmapped Tg(isl1:GAL4-VP16,14xUAS:Kaede) ZDB-TGCONSTRCT-120208-1 2019-09-17
ZDB-ALT-120208-2 a129Tg TgBAC_BX537129(trpa1b:EGFP)a129, TgBAC(trpa1b:EGFP)a129 Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped TgBAC(trpa1b:EGFP) ZDB-TGCONSTRCT-120208-2 2019-09-17
ZDB-ALT-001221-2 a13 nrb Point Mutation ENU Dowling Lab ZDB-LAB-970501-1 Chr: 21 2019-09-17
ZDB-ALT-130816-4 a130Tg Tg(14xUAS:LOX2272-LOXP-RFP-LOX2272-CFP-LOXP-YFP)a130 Transgenic Insertion embryos treated with DNA This line contains two copies of the transgene in the same locus (Pan et al., 2013). Schier Lab ZDB-LAB-970505-58 Unmapped Tg(14xUAS:LOX2272-LOXP-Tomato-LOX2272-Cerulean-LOXP-YFP) ZDB-TGCONSTRCT-130816-3 2019-09-17
ZDB-ALT-130816-2 a131Tg Tg(ubb:LOX2272-LOXP-RFP-LOX2272-CFP-LOXP-YFP)a131, ubi:Zebrabow-M Transgenic Insertion embryos treated with DNA This line has multiple independent insertions (Pan et al.,2013). Schier Lab ZDB-LAB-970505-58 Unmapped Tg(ubb:LOX2272-LOXP-Tomato-LOX2272-Cerulean-LOXP-YFP) ZDB-TGCONSTRCT-130816-1 2019-09-17
ZDB-ALT-180502-2 a13203Tg Transgenic Insertion embryos treated with DNA Robson Lab ZDB-LAB-180430-1 Unmapped Tg2(elavl3:GCaMP6s) ZDB-TGCONSTRCT-180326-1 2019-09-17
ZDB-ALT-130816-1 a132Tg Tg(ubb:LOX2272-LOXP-RFP-LOX2272-CFP-LOXP-YFP)a132, ubi:Zebrabow-S Transgenic Insertion embryos treated with DNA This line contains a single insertion of the transgene (Pan et al., 2013). Schier Lab ZDB-LAB-970505-58 Unmapped Tg(ubb:LOX2272-LOXP-Tomato-LOX2272-Cerulean-LOXP-YFP) ZDB-TGCONSTRCT-130816-1 2019-09-17
ZDB-ALT-130816-3 a133Tg Tg(4xUAS:LOX2272-LOXP-RFP-LOX2272-CFP-LOXP-YFP)a133, UAS:Zebrabow-B Transgenic Insertion embryos treated with DNA This line contains multiple independent insertions of the transgene (Pan et al., 2013). Schier Lab ZDB-LAB-970505-58 Unmapped Tg(4xUAS:LOX2272-LOXP-Tomato-LOX2272-Cerulean-LOXP-YFP) ZDB-TGCONSTRCT-130816-2 2019-09-17
ZDB-ALT-130816-5 a134Tg Tg2(hsp70l:Cre)a134 Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg2(hsp70l:Cre) ZDB-TGCONSTRCT-130816-4 2019-09-17
ZDB-ALT-140725-5 a135Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:galn) ZDB-TGCONSTRCT-140725-4 2019-09-17
ZDB-ALT-140725-4 a136Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:calca) ZDB-TGCONSTRCT-140725-3 2019-09-17
ZDB-ALT-140725-2 a137Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:cart3) ZDB-TGCONSTRCT-140725-2 2019-09-17
ZDB-ALT-140725-3 a138Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:cckb) ZDB-TGCONSTRCT-140811-4 2019-09-17
ZDB-ALT-140725-6 a139Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:pnocb) ZDB-TGCONSTRCT-140725-5 2019-09-17
ZDB-ALT-001221-4 a14 nrc Point Mutation Dowling Lab ZDB-LAB-970501-1 Chr: 10 2019-09-17
ZDB-ALT-140725-1 a140Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:adcyap1b) ZDB-TGCONSTRCT-140725-1 2019-09-17
ZDB-ALT-140611-6 a141 allele 7 Small Deletion embryos treated with TALEN1-apela TALEN-induced 4 nt deletion generates frameshift allele lacking the mature Toddler peptide\n(frameshift 2 amino acids after the signal peptidase cleavage site). Schier Lab ZDB-LAB-970505-58 Chr: 1 2019-09-17
ZDB-ALT-140611-7 a142 allele 3, allele 28 Indel TALEN TALEN1-apela TALEN-induced 12 nt deletion and 5 nt insertion generates frameshift allele lacking the
mature Toddler peptide (frameshift 2 amino acids after the signal peptidase cleavage site). Schier Lab ZDB-LAB-970505-58 Chr: 1 2019-09-17
ZDB-ALT-140429-1 a143Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:apela,myl7:EGFP) ZDB-TGCONSTRCT-140429-1 2019-09-17
ZDB-ALT-180417-4 a145 Indel embryos treated with TALEN1-lft1 Schier Lab ZDB-LAB-970505-58 Chr: 20 2019-09-17
ZDB-ALT-180417-5 a146 Small Deletion embryos treated with TALEN2-lft2 Schier Lab ZDB-LAB-970505-58 Chr: 17 2019-09-17
ZDB-ALT-150803-3 a147Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(actb2:EGFP-smad2) ZDB-TGCONSTRCT-150803-3 2019-09-17
ZDB-ALT-150803-4 a148Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(actb2:Hsa.HIST2H2BE-RFP) ZDB-TGCONSTRCT-150803-4 2019-09-17
ZDB-ALT-151028-3 a150Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(-6.7Tru.Hcrtr2:GAL4-VP16) ZDB-TGCONSTRCT-151028-8 2019-09-17
ZDB-ALT-151028-4 a151Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(14xUAS:GCaMP5) ZDB-TGCONSTRCT-151028-9 2019-09-17
ZDB-ALT-151028-5 a152Tg a144 Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(14xUAS-E1B:Cr.ChR2_H134R-EYFP) ZDB-TGCONSTRCT-151028-10 2019-09-17
ZDB-ALT-170630-3 a153 Small Deletion embryos treated with CRISPR1-polq, CRISPR2-polq, CRISPR3-polq Schier Lab ZDB-LAB-970505-58 Chr: 21 2019-09-17
ZDB-ALT-160404-4 a154Tg Transgenic Insertion embryos treated with DNA Engert Lab ZDB-LAB-070419-2 Unmapped Tg(elavl3:Hsa.HIST2H2BE-RFP) ZDB-TGCONSTRCT-160404-4 2019-09-17
ZDB-ALT-160406-1 a155Tg Transgenic Insertion embryos treated with DNA Engert Lab ZDB-LAB-070419-2 Unmapped Tg(UAS:sypb-GCaMP6s) ZDB-TGCONSTRCT-160406-1 2019-09-17
ZDB-ALT-161007-2 a158Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(ubb:DsRed-barcodev6,myl7:EGFP) ZDB-TGCONSTRCT-161007-4 2019-09-17
ZDB-ALT-161007-3 a159Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(ubb:DsRed-barcodev7,myl7:EGFP) ZDB-TGCONSTRCT-161007-5 2019-09-17
ZDB-ALT-180416-6 a160 Indel embryos treated with CRISPR1-kctd13, CRISPR2-kctd13, CRISPR3-kctd13, CRISPR4-kctd13 Schier Lab ZDB-LAB-970505-58 Chr: 3 2019-09-17
ZDB-ALT-161212-1 a161Tg Transgenic Insertion embryos treated with DNA Engert Lab ZDB-LAB-070419-2 Unmapped Tg(Cau.Tuba1:GCaMP2) ZDB-TGCONSTRCT-161212-1 2019-09-17
ZDB-ALT-180515-6 a164 Small Deletion embryos treated with CRISPR2-gdf3 Schier Lab ZDB-LAB-970505-58 Chr: 17 2019-09-17
ZDB-ALT-180515-7 a165 Small Deletion embryos treated with CRISPR2-gdf3 Schier Lab ZDB-LAB-970505-58 Chr: 17 2019-09-17
ZDB-ALT-180601-1 a166 Small Deletion embryos treated with TALEN3-nanog Schier Lab ZDB-LAB-970505-58 Chr: 24 2019-09-17
ZDB-ALT-180926-1 a167Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:DsRed-v7,myl7:EGFP) ZDB-TGCONSTRCT-180926-1 2019-09-17
ZDB-ALT-180926-2 a168Tg Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:zCas9-2A-EGFP,5x(U6:sgRNA)) ZDB-TGCONSTRCT-180926-2 2019-09-17
ZDB-ALT-180417-7 a169 Small Deletion embryos treated with CRISPR1-cxcr4a, CRISPR2-cxcr4a, CRISPR3-cxcr4a, CRISPR4-cxcr4a, CRISPR5-cxcr4a The 433 bp deletion generates a frameshift after the 28th amino acid. Schier Lab ZDB-LAB-970505-58 Chr: 6 2019-09-17
ZDB-ALT-180504-3 a170 Small Deletion embryos treated with CRISPR3-aplnrb Harbors a 1 bp deletion in the 52nd amino acid. Schier Lab ZDB-LAB-970505-58 Chr: 10 2019-09-17
ZDB-ALT-980203-792 a2 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-190422-8 a204 Small Deletion embryos treated with CRISPR1-dand5 Schier Lab ZDB-LAB-970505-58 Chr: 1 2019-09-17
ZDB-ALT-190422-9 a205 Small Deletion embryos treated with CRISPR2-spaw, CRISPR3-spaw Schier Lab ZDB-LAB-970505-58 Chr: 5 2019-09-17
ZDB-ALT-980203-581 a3 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-150323-1 a300Tg Transgenic Insertion embryos treated with DNA Cohen Lab ZDB-LAB-150218-2 Unmapped Tg(myl7:Hso.Arch_D95N-GCaMP5G) ZDB-TGCONSTRCT-150323-1 2019-09-17
ZDB-ALT-980203-371 a4 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-090324-2 a4593Tg Tg(trpa1b:EGFP)a4593 Transgenic Insertion DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(trpa1b:EGFP) ZDB-TGCONSTRCT-090324-1 2019-09-17
ZDB-ALT-110207-11 a4594Tg Tg(hsp70l:GFP-gli1)a4594 Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:GFP-gli1) ZDB-TGCONSTRCT-110203-6 2019-09-17
ZDB-ALT-120810-1 a4595Tg Tg(hsp70l:gli1)a4595 Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(hsp70l:gli1) ZDB-TGCONSTRCT-120810-2 2019-09-17
ZDB-ALT-120810-2 a4596Tg TgBAC(ptch2:Kaede)a4596 Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped TgBAC(ptch2:Kaede) ZDB-TGCONSTRCT-120810-1 2019-09-17
ZDB-ALT-130626-4 a4597Tg Tg(8xGBS:RFP-NLS)a4597 Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(8xGBS:RFP-NLS) ZDB-TGCONSTRCT-130626-1 2019-09-17
ZDB-ALT-130924-1 a4598Tg Tg(elavl3:GCaMP5G)a4598 Transgenic Insertion embryos treated with DNA Schier Lab ZDB-LAB-970505-58 Unmapped Tg(elavl3:GCaMP5G) ZDB-TGCONSTRCT-130924-1 2019-09-17
ZDB-ALT-980203-613 a5 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-001219-2 a50 Point Mutation adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Chr: 3 2019-09-17
ZDB-ALT-010731-9 a52 perplexed Point Mutation Dowling Lab ZDB-LAB-970501-1 Chr: 20 2019-09-17
ZDB-ALT-980203-758 a6 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-070514-5 a64 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-120822-2 a6793Tg Tg(elavl3:LMA-mCherry)a6793 Transgenic Insertion embryos treated with DNA Engert Lab ZDB-LAB-070419-2 Unmapped Tg(elavl3:LY-mCherry) ZDB-TGCONSTRCT-120822-1 2019-09-17
ZDB-ALT-061106-2 a69 Point Mutation Dowling Lab ZDB-LAB-970501-1 Chr: 24 2019-09-17
ZDB-ALT-980203-357 a7 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-120919-1 a7437Tg Tg(Cau.Tuba1:c3paGFP)a7437 Transgenic Insertion embryos treated with DNA Engert Lab ZDB-LAB-070419-2 Unmapped Tg(Cau.Tuba1:c3paGFP) ZDB-TGCONSTRCT-120919-1 2019-09-17
ZDB-ALT-030910-2 a75 H75 Unknown spontaneous The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-980203-416 a8 Point Mutation adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Chr: 3 2019-09-17
ZDB-ALT-980203-444 a9 (part of) Casper fish, (part of) Crystal fish Small Deletion spontaneous A 19 bp deletion was identified at the cDNA level, between exons2 and 3. This deletion is most likely due to aberrant splicing.
No exonic mutations that would have caused the splicing defect were detected.
The authors reported that they assumed that the underlying genomic defect occurs in the intron between exons 2 and 3, but they repeatedly failed to amplify the genomic DNA from intron 2–3, suggesting there is a deletion in this intron that leads to aberrant splicing and subsequent early stop of the mRNA. Dowling Lab ZDB-LAB-970501-1 Ambiguous 2019-09-17
ZDB-ALT-061204-8 acvr1l_unspecified un_acvr1, un_acvr1l, un_laf, unspecified_acvr1l Unspecified Chr: 2 2019-09-17
ZDB-ALT-140616-3 ae10Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg(buc:mApple) ZDB-TGCONSTRCT-140616-1 2019-09-17
ZDB-ALT-160120-2 ae11 Small Deletion embryos treated with CRISPR1-kif5ba The ae11 allele of kif5ba has a 5 base pair (bp) deletion predicted to produce a premature stop codon. (Campbell et al. ZDB-PUB-150809-7 ). Homozygotes are viable and fertile. Mkif5ba and MZkif5ba adult mutants are sterile males. Marlow Lab ZDB-LAB-080819-1 Ambiguous 2019-09-17
ZDB-ALT-160120-3 ae12 Small Deletion embryos treated with CRISPR1-kif5ba The ae12 allele of kif5ba has a 6 bp deletion predicted to delete two amino acids. (Campbell et al. ZDB-PUB-150809-7). Homozygotes are viable and fertile. Mkif5ba and MZkif5ba adult mutants are sterile males. Marlow Lab ZDB-LAB-080819-1 Ambiguous 2019-09-17
ZDB-ALT-150624-3 ae14Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg(hsp70l:2xMCP-NLS-EGFP) ZDB-TGCONSTRCT-150624-3 2019-09-17
ZDB-ALT-150624-4 ae15Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg(actb2:2xMCP-NLS-EGFP) ZDB-TGCONSTRCT-150624-4 2019-09-17
ZDB-ALT-051123-4 ae1Tg ae1, Tg(-14.8gata4:GFP), Tg(-14.8gata4:GFP)ae1 Transgenic Insertion embryos treated with DNA Evans Lab ZDB-LAB-051005-1 Unmapped Tg(-14.8gata4:GFP) ZDB-TGCONSTRCT-070117-5 2019-09-17
ZDB-ALT-171003-15 ae21 Small Deletion embryos treated with CRISPR1-kif5bb The mutation disrupts the N-terminal motor domain. Marlow Lab ZDB-LAB-080819-1 Ambiguous 2019-09-17
ZDB-ALT-171003-16 ae22 Small Deletion embryos treated with CRISPR1-kif5bb The mutation disrupts the N-terminal motor domain. Marlow Lab ZDB-LAB-080819-1 Ambiguous 2019-09-17
ZDB-ALT-171003-17 ae23 Small Deletion embryos treated with CRISPR1-kif5bb The mutation disrupts the N-terminal motor domain. Marlow Lab ZDB-LAB-080819-1 Ambiguous 2019-09-17
ZDB-ALT-171003-18 ae24 Insertion embryos treated with CRISPR1-kif5bb The mutation disrupts the N-terminal motor domain. Marlow Lab ZDB-LAB-080819-1 Ambiguous 2019-09-17
ZDB-ALT-190111-1 ae27 Small Deletion embryos treated with CRISPR1-rbpms2a Marlow Lab ZDB-LAB-080819-1 Chr: 25 2019-09-17
ZDB-ALT-051123-6 ae2Tg ae2, Tg(-14.8gata4:GFP), Tg(-14.8gata4:GFP)ae2 Transgenic Insertion embryos treated with DNA Evans Lab ZDB-LAB-051005-1 Unmapped Tg(-14.8gata4:GFP) ZDB-TGCONSTRCT-070117-5 2019-09-17
ZDB-ALT-190111-2 ae30 Indel embryos treated with CRISPR1-rbpms2a Marlow Lab ZDB-LAB-080819-1 Chr: 25 2019-09-17
ZDB-ALT-190205-12 ae32 Insertion embryos treated with CRISPR1-rbpms2b 20 bp insertion. Marlow Lab ZDB-LAB-080819-1 Chr: 7 2019-09-17
ZDB-ALT-051123-8 ae3Tg ae3, Tg(-7.8gata4:GFP), Tg(-7.8gata4:GFP)ae3 Transgenic Insertion embryos treated with DNA Evans Lab ZDB-LAB-051005-1 Unmapped Tg(-7.8gata4:GFP) ZDB-TGCONSTRCT-070117-130 2019-09-17
ZDB-ALT-051123-2 ae4Tg ae4, Tg(-11gata4:GFP), Tg(-11gata4:GFP)ae4 Transgenic Insertion embryos treated with DNA Evans Lab ZDB-LAB-051005-1 Unmapped Tg(-11gata4:GFP) ZDB-TGCONSTRCT-070117-62 2019-09-17
ZDB-ALT-190205-10 ae58Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg(buc:mApple-rbpms2b) ZDB-TGCONSTRCT-190205-2 2019-09-17
ZDB-ALT-190205-11 ae59Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg2(buc:mApple-rbpms2b) ZDB-TGCONSTRCT-190205-3 2019-09-17
ZDB-ALT-051123-10 ae5Tg ae5, Tg(gata6:GFP), Tg(gata6:GFP)ae5 Transgenic Insertion embryos treated with DNA Evans Lab ZDB-LAB-051005-1 Unmapped Tg(gata6:GFP) ZDB-TGCONSTRCT-070117-96 2019-09-17
ZDB-ALT-140612-1 ae6Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg1(buc:buc) ZDB-TGCONSTRCT-140612-1 2019-09-17
ZDB-ALT-140612-2 ae7Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg2(buc:buc) ZDB-TGCONSTRCT-140612-2 2019-09-17
ZDB-ALT-140612-3 ae8Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg3(buc:buc) ZDB-TGCONSTRCT-140612-3 2019-09-17
ZDB-ALT-140612-4 ae9Tg Transgenic Insertion embryos treated with DNA Marlow Lab ZDB-LAB-080819-1 Unmapped Tg4(buc:buc) ZDB-TGCONSTRCT-140612-4 2019-09-17
ZDB-ALT-180816-2 af1Tg Transgenic Insertion embryos treated with DNA Heermann Lab ZDB-LAB-150610-1 Unmapped Tg(hsp70l:bmp4,myl7:EGFP) ZDB-TGCONSTRCT-180816-1 2019-09-17
ZDB-ALT-180816-3 af2Tg Transgenic Insertion embryos treated with DNA Heermann Lab ZDB-LAB-150610-1 Unmapped Tg(SBE:GFP-CAAX) ZDB-TGCONSTRCT-180816-2 2019-09-17
ZDB-ALT-180816-4 af3Tg Transgenic Insertion embryos treated with DNA Heermann Lab ZDB-LAB-150610-1 Unmapped Tg(Mmu.Foxa2-cryaa:mCherry) ZDB-TGCONSTRCT-110310-3 2019-09-17
ZDB-ALT-140924-1 ahc1Tg Transgenic Insertion embryos treated with DNA Trapani Lab ZDB-LAB-110706-1 Unmapped Tg(myo6b:Cr.ChR2-EYFP) ZDB-TGCONSTRCT-140924-1 2019-09-17
ZDB-ALT-131204-1 ai1Tg Tg(myl7:Kaede)ai1 Transgenic Insertion DNA Oishi Lab ZDB-LAB-130110-1 Unmapped Tg3(myl7:Kaede) ZDB-TGCONSTRCT-131204-1 2019-09-17
ZDB-ALT-180131-2 aik1 zf786 Small Deletion embryos treated with CRISPR1-ldlrap1a Target sequence is in exon 2. Mutagenesis resulted in a 7bp deletion 95 bp into exon 2, of the following underlined bases GGTGGACCAACCTAAAGGAGAGGAGCTCTCAGCT, resulting in GGTGGACCAACCTNNNNNNNAGGAGCTCT. This causes a frameshift resulting missense and a premature stop codon 37bp into exon 3. The mutation is predicted to disrupt the pleckstrin homology domain (PH domain) early in the sequence and any subsequent functional domains.
GRCz10 Chr19:29762445-29762451 deleted DeLaurier Lab ZDB-LAB-180131-1 Chr: 19 2019-09-17
ZDB-ALT-190627-6 aik2 Insertion embryos treated with CRISPR1-hdac4 DeLaurier Lab ZDB-LAB-180131-1 Chr: 9 2019-09-17
ZDB-ALT-190627-7 aik3 Insertion embryos treated with CRISPR1-hdac4 DeLaurier Lab ZDB-LAB-180131-1 Chr: 9 2019-09-17
ZDB-ALT-190606-1 aik4 Small Deletion embryos treated with CRISPR1-phf21aa Aik4 is a 7 bp deletion located in exon 6 of the phf21aa gene, causing a frameshift resulting in extensive missense and a premature stop codon DeLaurier Lab ZDB-LAB-180131-1 Chr: 7 2019-09-17
ZDB-ALT-181212-1 ama008632Tg Transgenic Insertion embryos treated with DNA UMS AMAGEN CNRS INRA ZDB-LAB-150303-2 Unmapped Tg(actb1:NLS-TagRFP) ZDB-TGCONSTRCT-181212-1 2019-09-17
ZDB-ALT-151110-5 ama605003 Small Deletion embryos treated with TALEN1-col6a1 Radev et al (2015): Talen pair targets the junction between exon and intron 14; 2 bp deletion; lead to skipping of exon 14 UMS AMAGEN CNRS INRA ZDB-LAB-150303-2 Chr: 11 2019-09-17
ZDB-ALT-140725-7 amc1 R44X Point Mutation adult males treated with ENU Baas Lab ZDB-LAB-140716-1 Chr: 14 2019-09-17
ZDB-ALT-140725-8 amc2 L35R Point Mutation adult males treated with ENU Baas Lab ZDB-LAB-140716-1 Chr: 14 2019-09-17
ZDB-ALT-091027-47 arhgap21b_unrecovered un_arhgap21b, unrec_arhgap21b, unrecovered_arhgap21b, unrec_spork Point Mutation adult males treated with ENU Chr: 2 2019-09-17
ZDB-ALT-110126-5 as100Tg Tg(cyp19a1b:cyp19a1b-GFP)as100 Transgenic Insertion embryos treated with DNA Chung Lab ZDB-LAB-980527-1 Unmapped Tg(cyp19a1b:cyp19a1b-GFP) ZDB-TGCONSTRCT-110126-4 2019-09-17
ZDB-ALT-141209-1 as101Tg Transgenic Insertion embryos treated with DNA Chung Lab ZDB-LAB-980527-1 Unmapped Tg(gnrh3:GFP-Eco.Lacz) ZDB-TGCONSTRCT-141209-1 2019-09-17
ZDB-ALT-140910-2 as11Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-6.0agr2:EGFP) ZDB-TGCONSTRCT-140910-2 2019-09-17
ZDB-ALT-140910-3 as12Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-3.3agr2:EGFP) ZDB-TGCONSTRCT-140910-3 2019-09-17
ZDB-ALT-140910-4 as13Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-2.6agr2:EGFP) ZDB-TGCONSTRCT-140910-4 2019-09-17
ZDB-ALT-140910-5 as14Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-2.4agr2:EGFP) ZDB-TGCONSTRCT-140910-5 2019-09-17
ZDB-ALT-140910-6 as15Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-2.0agr2:EGFP) ZDB-TGCONSTRCT-140910-6 2019-09-17
ZDB-ALT-161102-15 as16Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-5.3agr2:EGFP) ZDB-TGCONSTRCT-161102-11 2019-09-17
ZDB-ALT-161102-14 as17Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-4.5agr2:EGFP) ZDB-TGCONSTRCT-161102-10 2019-09-17
ZDB-ALT-161102-13 as18Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-4.2agr2:EGFP) ZDB-TGCONSTRCT-161102-9 2019-09-17
ZDB-ALT-161102-16 as19Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(agr2:EGFP) ZDB-TGCONSTRCT-161102-12 2019-09-17
ZDB-ALT-031209-4 as1Tg as1, Tg(-7.5bmp4:GFP), Tg(-7.5bmp4:GFP)as1 Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-7.5bmp4:GFP) ZDB-TGCONSTRCT-070117-72 2019-09-17
ZDB-ALT-110208-3 as200Tg Tg(fabp2:RFP)as200 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(fabp2:RFP) ZDB-TGCONSTRCT-110208-2 2019-09-17
ZDB-ALT-110505-1 as201Tg Tg(zp3.2:Eco.NsfB-EGFP)as201, Tg(zp3:Eco.NsfB-EGFP)as201 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(zp3.2:Eco.NfsB-EGFP) ZDB-TGCONSTRCT-110505-1 2019-09-17
ZDB-ALT-110505-6 as202Tg Tg(zp3.2:Omo.Igf1-Rre.GFP)as202 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(zp3.2:Omo.Igf1-Rre.GFP) ZDB-TGCONSTRCT-110505-6 2019-09-17
ZDB-ALT-110505-7 as203Tg Tg(zp3.2:Omo.Igf2-Rre.GFP)as203 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(zp3.2:Omo.Igf2-Rre.GFP) ZDB-TGCONSTRCT-110505-7 2019-09-17
ZDB-ALT-161102-17 as20Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg2(agr2:EGFP) ZDB-TGCONSTRCT-161102-13 2019-09-17
ZDB-ALT-161102-19 as21Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg3(agr2:EGFP) ZDB-TGCONSTRCT-161102-14 2019-09-17
ZDB-ALT-161102-18 as22Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg4(agr2:EGFP) ZDB-TGCONSTRCT-161102-15 2019-09-17
ZDB-ALT-161102-20 as23Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(Hsa.AGR2-agr2:EGFP) ZDB-TGCONSTRCT-161102-16 2019-09-17
ZDB-ALT-161102-21 as24Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg2(Hsa.AGR2-agr2:EGFP) ZDB-TGCONSTRCT-161102-17 2019-09-17
ZDB-ALT-161102-22 as25Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg3(Hsa.AGR2-agr2:EGFP) ZDB-TGCONSTRCT-161102-18 2019-09-17
ZDB-ALT-161102-23 as26Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg4(Hsa.AGR2-agr2:EGFP) ZDB-TGCONSTRCT-161102-19 2019-09-17
ZDB-ALT-161102-24 as27Tg Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg5(Hsa.AGR2-agr2:EGFP) ZDB-TGCONSTRCT-161102-20 2019-09-17
ZDB-ALT-180212-1 as28 d25 Small Deletion embryos treated with CRISPR1-klf8 Hwang Lab ZDB-LAB-970417-28 Chr: 21 2019-09-17
ZDB-ALT-180212-2 as29 i17 Insertion embryos treated with CRISPR1-klf8 Hwang Lab ZDB-LAB-970417-28 Chr: 21 2019-09-17
ZDB-ALT-031209-2 as2Tg as2, Tg(-7.5bmp4:GFP), Tg(-7.5bmp4:GFP)as2 Transgenic Insertion embryos treated with DNA Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(-7.5bmp4:GFP) ZDB-TGCONSTRCT-070117-72 2019-09-17
ZDB-ALT-160328-1 as301Tg Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(fabp10a:TETA,TETRE-CMV:GFP,Ssa.Fads2) ZDB-TGCONSTRCT-160328-1 2019-09-17
ZDB-ALT-160328-2 as302Tg Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(fabp10a:TETA,TETRE-CMV:RFP,Ssa.Elovl5) ZDB-TGCONSTRCT-160328-2 2019-09-17
ZDB-ALT-181016-1 as31Gt This feature is representative of one or more unknown insertion sites. as31Tg Transgenic Insertion embryos treated with DNA The insertion of GAL4-VP16,UAS:EGFP plasmid was located in intron 1 of the si:ch211-74m13.3 gene (ZFIN ID: ZDB-GENE-060503-219) on chromosome 3. Two splice variants (si:ch211-74m13.3-201, si:ch11-74m13.3-202) consisting of seven or five exons were produced. The variants encode vascular cell adhesion protein 1 isoform X1 (VCAP1X1) (XP_002661307.2, 551 amino acids) and vascular cell adhesion protein 1 isoform X2 (VCAP1X2) (XP_005164393.1, 360 amino acids). Hwang Lab ZDB-LAB-970417-28 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-060627-2 as3Tg as3, Tg(-2.8fabp10:EGFP), Tg(-2.8fabp10:EGFP)as3, Tg(-2.8fabp10:EGFP)unspecified Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(-2.8fabp10a:EGFP) ZDB-TGCONSTRCT-070117-123 2019-09-17
ZDB-ALT-090504-5 as4Tg Tg(sncgb:GFP)as4 Transgenic Insertion embryos treated with DNA This line is available at the Taiwan Zebrafish Core Facility at Academia Sinica (ZCAS). Ru Chih C. Huang Lab ZDB-LAB-970409-116 Unmapped Tg(sncgb:GFP) ZDB-TGCONSTRCT-090504-2 2019-09-17
ZDB-ALT-140210-1 as501Tg Tg(fabp10a:TETA,TETRE-CMV:EGFP)as501 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(fabp10a:TETA,TETRE-CMV:EGFP) ZDB-TGCONSTRCT-140210-1 2019-09-17
ZDB-ALT-140210-2 as502Tg Tg(fabp10a:TETA,TETRE-CMV:EGFP,TETRE-CMV:HBV.HBx)as502 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(fabp10a:TETA,TETRE-CMV:EGFP,TETRE-CMV:HBV.HBx) ZDB-TGCONSTRCT-140210-2 2019-09-17
ZDB-ALT-140210-3 as503Tg Tg(fabp10a:TETA,TETRE-CMV:EGFP,TETRE-CMV:HCV.Cp)as503 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(fabp10a:TETA,TETRE-CMV:EGFP,TETRE-CMV:HCV.Cp) ZDB-TGCONSTRCT-140210-3 2019-09-17
ZDB-ALT-140210-4 as504Tg Tg(fabp10a:TETA,TETRE-CMV:HsRed,TETRE-CMV:EGFP,TETRE-CMV:HBV.HBx,TETRE-CMV:HCV.Cp)as504 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(fabp10a:TETA,TETRE-CMV:HsRed,TETRE-CMV:EGFP,TETRE-CMV:HBV.HBx,TETRE-CMV:HCV.Cp) ZDB-TGCONSTRCT-140210-4 2019-09-17
ZDB-ALT-190423-3 as51 Point Mutation adult males treated with ENU Chen-Hui Chen Lab ZDB-LAB-190304-1 Chr: 8 2019-09-17
ZDB-ALT-190423-4 as52 Complex embryos treated with CRISPR3-pola2, CRISPR4-pola2 pola2-201, ENSDART00000025803.7, a deletion between exon 3 and exon 6, a 9 bp insertion of AACAAACGG at 109 bp, a 289 bp deletion between 109 bp and 399 bp, premature stop codon at amino acid 21 Chen-Hui Chen Lab ZDB-LAB-190304-1 Chr: 8 2019-09-17
ZDB-ALT-190423-5 as53 Complex embryos treated with CRISPR1-plk2b, CRISPR2-plk2b plk2b-201, ENSDART00000023206.8, a deletion between exon 12 and exon 14, a 379 bp deletion between 1606bp and 1986 bp, premature stop codon at amino acid 536. Chen-Hui Chen Lab ZDB-LAB-190304-1 Chr: 8 2019-09-17
ZDB-ALT-110128-47 as5Tg Tg(rtn4a-002:GFP)as5 Transgenic Insertion embryos treated with DNA Chang-Jen Huang Lab ZDB-LAB-031201-1 Unmapped Tg(rtn4a-002:GFP) ZDB-TGCONSTRCT-110128-11 2019-09-17
ZDB-ALT-110128-48 as6Tg Tg(rtn4a-003:GFP)as6 Transgenic Insertion embryos treated with DNA Chang-Jen Huang Lab ZDB-LAB-031201-1 Unmapped Tg(rtn4a-003:GFP) ZDB-TGCONSTRCT-110128-12 2019-09-17
ZDB-ALT-110128-49 as7Tg Tg(rtn4a-004:GFP)as7 Transgenic Insertion embryos treated with DNA Chang-Jen Huang Lab ZDB-LAB-031201-1 Unmapped Tg(rtn4a-004:GFP) ZDB-TGCONSTRCT-110128-13 2019-09-17
ZDB-ALT-120409-1 as890Tg Tg(CMV:EGFP,CMV:Cca.M3ck)as890 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(CMV:EGFP,CMV:Cca.M3ck) ZDB-TGCONSTRCT-120409-1 2019-09-17
ZDB-ALT-121112-4 as891Tg Tg(CMV:EGFP,hsc70:Cca.Ckm3)as891 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(CMV:EGFP,hsc70:Cca.Ckm3) ZDB-TGCONSTRCT-121112-3 2019-09-17
ZDB-ALT-130729-1 as892Tg Tg(mylpfa:EGFP)as892 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(mylpfa:EGFP) ZDB-TGCONSTRCT-130726-1 2019-09-17
ZDB-ALT-130729-2 as893Tg Tg(mylpfa:grna)as893 Transgenic Insertion embryos treated with DNA Jen-Leih Wu Lab ZDB-LAB-000913-1 Unmapped Tg(mylpfa:grna) ZDB-TGCONSTRCT-130726-2 2019-09-17
ZDB-ALT-131108-1 as8Tg Tg2(elavl3:EGFP)as8 Transgenic Insertion embryos treated with DNA This line is available at the Taiwan Zebrafish Core Facility at Academia Sinica (ZCAS). Chang-Jen Huang Lab ZDB-LAB-031201-1 Unmapped Tg2(elavl3:EGFP) ZDB-TGCONSTRCT-131108-1 2019-09-17
ZDB-ALT-140224-1 as9Tg Transgenic Insertion embryos treated with DNA Chang-Jen Huang Lab ZDB-LAB-031201-1 Unmapped Tg(col2a1a:GFP) ZDB-TGCONSTRCT-140224-1 2019-09-17
ZDB-ALT-050209-56 ascl1a_unspecified un_ascl1a, un_pia, unspecified_ascl1a Unspecified Chr: 4 2019-09-17
ZDB-ALT-141113-2 asj10Tg Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(TETRE-CMV:CFP,Ssa.Fadsd5) ZDB-TGCONSTRCT-141009-2 2019-09-17
ZDB-ALT-141113-3 asj11Tg Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(TETRE-CMV:PFP,Ssa.Fadsd6) ZDB-TGCONSTRCT-141009-1 2019-09-17
ZDB-ALT-110307-4 asj1Tg Tg(mylz2:EGFP,mylz2:Omo.Hamp1)asj1 Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(mylpfa:EGFP,mylpfa:Omo.Hamp1) ZDB-TGCONSTRCT-110307-3 2019-09-17
ZDB-ALT-110304-3 asj2Tg Tg(-2.5mylz2:DsRed)asj2 Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(-2.5mylpfa:DsRed) ZDB-TGCONSTRCT-110304-2 2019-09-17
ZDB-ALT-110304-4 asj3Tg Tg(-2.5mylz2:Eco.Epinecidin1-DsRed)asj3, Tg(-2.5mylz2:Epinecidin1-DsRed)asj3 Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(-2.5mylpfa:Eco.Epinecidin1-DsRed) ZDB-TGCONSTRCT-110304-3 2019-09-17
ZDB-ALT-111012-1 asj4Tg Tg(mylpfa:EGFP,mylpfa:Omo.Hepcidin)asj4 Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(mylpfa:EGFP,mylpfa:Omo.Hepcidin) ZDB-TGCONSTRCT-111012-2 2019-09-17
ZDB-ALT-111012-2 asj5Tg Tg(mylpfa:EGFP,mylpfa:Pmo.Chelonianin)asj5 Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(mylpfa:EGFP,mylpfa:Pmo.Chelonianin) ZDB-TGCONSTRCT-111012-5 2019-09-17
ZDB-ALT-140217-1 asj6Tg Tg(amh-LOXP-CMV:NPT-HcRed-LOXP-baxb,baxa)asj6 Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(amh-LOXP-CMV:NPT-HcRed-LOXP-baxb,baxa) ZDB-TGCONSTRCT-140217-1 2019-09-17
ZDB-ALT-140217-2 asj7Tg Tg(zp3.2-LOXP-CMV:NPT-HcRed-LOXP-baxb,baxa)asj7 Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(zp3.2-LOXP-CMV:NPT-HcRed-LOXP-baxb,baxa) ZDB-TGCONSTRCT-140217-2 2019-09-17
ZDB-ALT-140217-3 asj8Tg Tg(LOXP-CMV:Cre,CMV:EGFP)asj8 Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(LOXP-CMV:Cre,CMV:EGFP) ZDB-TGCONSTRCT-140217-3 2019-09-17
ZDB-ALT-141113-1 asj9Tg Transgenic Insertion embryos treated with DNA JY Chen Lab ZDB-LAB-110209-1 Unmapped Tg(Oni.Mlc3:TETA) ZDB-TGCONSTRCT-141113-1 2019-09-17
ZDB-ALT-091027-8 atoh1a_unrecovered un_atoh1a, unrec_atoh1a, unrecovered_atoh1a Point Mutation adult males treated with ENU Chr: 8 2019-09-17
ZDB-ALT-140130-9 au1 uta1 Point Mutation adult males treated with ENU G->A at the intron 4 splice-acceptor site resulting in the removal of the first 57bp of exon 5; 19 amino acids are absent from the Ptch2 protein Gross Lab ZDB-LAB-050914-1 Chr: 2 2019-09-17
ZDB-ALT-140130-18 au10 uta10 Point Mutation adult males treated with ENU Hartsock et al (20014): A to T transversion at nucleotide 301 of the mab21l2 coding sequence. This mutation generates a premature stop codon at amino acid 101 (K101STOP), truncating the protein by ~66%. Gross Lab ZDB-LAB-050914-1 Chr: 1 2019-09-17
ZDB-ALT-180612-2 au101Tg Transgenic Insertion embryos treated with DNA Eberhart Lab ZDB-LAB-100716-1 Unmapped Tg(-0.5unc45b:mCherry) ZDB-TGCONSTRCT-180612-1 2019-09-17
ZDB-ALT-181203-4 au106Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(-1.2celf1:EGFP) ZDB-TGCONSTRCT-181203-2 2019-09-17
ZDB-ALT-140130-19 au13 uta13 Unknown adult males treated with ENU In complementation test au13 fails to complement the nsfb au18 mutation, suggesting that they possess mutations in the same gene. Injection of nsfbWT mRNA rescued the mutant phenotype in embryos from an au13 heterozygous incross. In addition nsfb expression was reduced ~2.4-fold in au13 fish relative to wild-type embryos. Gross Lab ZDB-LAB-050914-1 Chr: 12 2019-09-17
ZDB-ALT-140130-20 au16 uta16 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-21 au17 uta17 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-22 au18 uta18 Point Mutation adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Chr: 12 2019-09-17
ZDB-ALT-140130-23 au19 uta19 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-10 au2 uta2 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-24 au20 uta20 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-25 au21 uta21 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-26 au22 uta22 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-11 au3 uta3 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-12 au4 uta4 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-140130-13 au5 uta5 Point Mutation adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Chr: 24 2019-09-17
ZDB-ALT-180207-1 au59 Small Deletion embryos treated with TALEN3-tet2 c.1,219_1, 229delATAGATTTAA, p.Ile407Thrfs*3 ;
protein truncation before the catalytic domain; 10bp deletion predicted to cause a frameshift beginning at amino acid (aa) 407, inserting 37 incorrect amino acids and truncating the protein at aa 444 out of 1,716 Gross Lab ZDB-LAB-050914-1 Chr: 1 2019-09-17
ZDB-ALT-140130-14 au6 uta6 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-180207-2 au60 Indel embryos treated with TALEN3-tet3 c.4,860_4,881delGAGATAAACTGTACAGAGAAGT,
p.Gly1,212Alafs*92 ;
protein truncation before the catalytic domain; 22bp deletion mutation predicted to cause a frameshift beginning at aa 1,212, inserting 92 incorrect aa and truncating the tet3 protein at aa 1,304 out of 2,052 Gross Lab ZDB-LAB-050914-1 Chr: 5 2019-09-17
ZDB-ALT-160921-8 au66Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:mCherry-2A-MYC-Hsa.CDC42,myl7:EGFP) ZDB-TGCONSTRCT-160921-7 2019-09-17
ZDB-ALT-160921-9 au67Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:mCherry-2A-MYC-Hsa.CDC42_T17N,myl7:EGFP) ZDB-TGCONSTRCT-160921-8 2019-09-17
ZDB-ALT-160921-10 au68Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:mCherry-2A-MYC-caHsa.CDC42_G12V,myl7:EGFP) ZDB-TGCONSTRCT-170816-1 2019-09-17
ZDB-ALT-160922-2 au69Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:mCherry-2A-MYC-dnXla.Cdc42_F37A,myl7:EGFP) ZDB-TGCONSTRCT-160922-2 2019-09-17
ZDB-ALT-140130-15 au7 uta7 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-160922-1 au70Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:EGFP-2A-Hsa.RAC1,myl7:EGFP) ZDB-TGCONSTRCT-160922-3 2019-09-17
ZDB-ALT-160922-3 au71Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:EGFP-2A-dnHsa.RAC1_T17N,myl7:EGFP) ZDB-TGCONSTRCT-160922-4 2019-09-17
ZDB-ALT-160922-4 au72Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:EGFP-2A-caHsa.RAC1_G12V,myl7:EGFP) ZDB-TGCONSTRCT-170816-2 2019-09-17
ZDB-ALT-160922-5 au73Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:mCherry-2A-MYC-Hsa.RHOA,myl7:EGFP) ZDB-TGCONSTRCT-160922-6 2019-09-17
ZDB-ALT-160922-6 au74Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:mCherry-2A-MYC-dnHsa.RHOA_T19N,myl7:EGFP) ZDB-TGCONSTRCT-160922-7 2019-09-17
ZDB-ALT-160922-7 au75Tg Transgenic Insertion embryos treated with DNA Gross Lab ZDB-LAB-050914-1 Unmapped Tg(10xUAS:mCherry-2A-MYC-caHsa.RHOA_Q63L,myl7:EGFP) ZDB-TGCONSTRCT-160922-8 2019-09-17
ZDB-ALT-140130-16 au8 uta8 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-100518-1 au82 a82 Point Mutation ENU au82 has a nonsense mutation (TTG -> TAG) at nt 317 of atp6ap1 coding sequence, leading to a truncated protein product.. reference: ZDB-PUB-081008-15 Gross Lab ZDB-LAB-050914-1 Chr: 23 2019-09-17
ZDB-ALT-140130-17 au9 uta9 Unknown adult males treated with ENU Gross Lab ZDB-LAB-050914-1 Unmapped 2019-09-17
ZDB-ALT-050209-14 aus_unspecified un_aus, unspecified_aus Unspecified Unmapped 2019-09-17
ZDB-ALT-181010-1 az1 Complex embryos treated with CRISPR4-myl7 variation #1: C>T ; [GRCz11] Chr 8:40464031-40464031
variation #2: insertion of 5bp (GTGCC); [GRCz11] Chr8:40464020-40464021 Sato Lab ZDB-LAB-131119-1 Chr: 8 2019-09-17
ZDB-ALT-181010-10 az10 Small Deletion embryos treated with CRISPR1-otpb Sato Lab ZDB-LAB-131119-1 Chr: 5 2019-09-17
ZDB-ALT-181010-2 az2 Insertion embryos treated with CRISPR4-myl7 Sato Lab ZDB-LAB-131119-1 Chr: 8 2019-09-17
ZDB-ALT-181010-3 az3 Indel embryos treated with CRISPR1-cmlc1 Sato Lab ZDB-LAB-131119-1 Chr: 5 2019-09-17
ZDB-ALT-181010-4 az4 Insertion embryos treated with CRISPR1-cmlc1 Sato Lab ZDB-LAB-131119-1 Chr: 5 2019-09-17
ZDB-ALT-181010-5 az5 Small Deletion embryos treated with CRISPR1-tnnc1a Sato Lab ZDB-LAB-131119-1 Chr: 23 2019-09-17
ZDB-ALT-181010-6 az6 Indel embryos treated with CRISPR1-tnnc1a Sato Lab ZDB-LAB-131119-1 Chr: 23 2019-09-17
ZDB-ALT-181010-7 az7 Indel embryos treated with CRISPR1-otpa Sato Lab ZDB-LAB-131119-1 Chr: 21 2019-09-17
ZDB-ALT-181010-8 az8 Indel embryos treated with CRISPR1-otpa Sato Lab ZDB-LAB-131119-1 Chr: 21 2019-09-17
ZDB-ALT-181010-9 az9 Small Deletion embryos treated with CRISPR1-otpb Sato Lab ZDB-LAB-131119-1 Chr: 5 2019-09-17
ZDB-ALT-970801-19 b1 Point Mutation spontaneous Streisinger Lab ZDB-LAB-980209-8 Chr: 18 2019-09-17
ZDB-ALT-070306-2 b1006 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-180612-3 b1024 Point Mutation ENU b1024 has a single base substitution (C > T) seven bases into exon 6 of cyp26b1 (RefSeq NM_212666). This variant creates an early stop codon (p. Gln384, RefSeq NP_997831) that is predicted to truncate the last 128, of 511 total, amino acids of Cyp26b1. A single cytochrome P450 superfamily domain comprises most of the protein sequence. This lesion in cyp26b1 truncates 23% of the P450 domain, including the highly conserved heme-binding loop in exon 6, which is required for enzymatic activity. We conclude that b1024 is a recessive loss-of-function, likely null, allele of cyp26b1 ... Kimmel Lab ZDB-LAB-970408-13 Chr: 7 2019-09-17
ZDB-ALT-070306-10 b1035 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-070306-11 b1037 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-070306-12 b1039 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-980224-16 b104 b104, b104rl, Df(LG08), Df(LG08)b104, Df(LG08)tbx16 Indel spontaneous The origin of this mutation is not determined. The b104 mutation removes nucleotides +660-745 and introduces 8 extra bases (AAATTAAA) containing an in-frame stop. Kimmel Lab ZDB-LAB-970408-13 Chr: 8 2019-09-17
ZDB-ALT-100526-5 b1048 Point Mutation ENU pif b1048 contained a 10642C>T transversion in fras1, generating a premature stop codon at amino acid residue 3548. (Carney et al. ZDB-PUB-100427-24 ) Kimmel Lab ZDB-LAB-970408-13 Chr: 5 2019-09-17
ZDB-ALT-081006-2 b1059 Point Mutation ENU mutation in the second tyrosine kinase domain (amino acids 841-870) Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Ambiguous 2019-09-17
ZDB-ALT-980203-336 b107 Small Deletion embryos treated with g-rays Fails to complement tk48d. Sepich et al., (1998) show that the nic1 mutant gene lacked approximately 1kb of intron 6. Westerfield Lab ZDB-LAB-970408-1 Chr: 6 2019-09-17
ZDB-ALT-141222-1 b1071 opallus Point Mutation sperm treated with ENU McMenamin et al (2014): semi-dominant opallus allele. Missense mutation (Asp632 → Tyr) in thyroid stimulating hormone receptor (tshr). The lesion in tshr g1894t/D632Y corresponds to human activating mutation D633Y. Eisen Lab ZDB-LAB-970408-42 Chr: 20 2019-09-17
ZDB-ALT-070306-13 b1074 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-131219-18 b1075 Point Mutation b1075 has a thymidine to adenosine point mutation within exon 4 of gata3 resulting in a predicted cysteine to serine missense mutation in the zinc ion (Zn2+)-coordinating domain of zinc finger 2. Mutation of the homologous cysteine has been shown to cause HDR (hypoparathyroidism, sensorineural deafness, renal dysplasia) syndrome in humans.
Reference: Sheehan-Rooney et al. (2013) Kimmel Lab ZDB-LAB-970408-13 Chr: 4 2019-09-17
ZDB-ALT-041124-2 b1085 Unknown Eisen Lab ZDB-LAB-970408-42 Chr: 6 2019-09-17
ZDB-ALT-071023-1 b1086 Point Mutation ENU Kimmel Lab ZDB-LAB-970408-13 Chr: 10 2019-09-17
ZDB-ALT-061023-2 b1088 Unknown Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-980203-593 b109 Small Deletion embryos treated with g-rays A deletion of 13 bp in the 5' non-transcribed region (–258 to –271) is found in b109 mutants. Kimmel Lab ZDB-LAB-970408-13 Chr: 23 2019-09-17
ZDB-ALT-111206-1 b1100 Point Mutation Kimmel Lab ZDB-LAB-970408-13 Chr: 14 2019-09-17
ZDB-ALT-060811-6 b1105 Point Mutation ENU G to A transition causes a trp223-> stop. Crump Lab ZDB-LAB-060809-1 Chr: 13 2019-09-17
ZDB-ALT-120221-11 b1110 Point Mutation embryos treated with ENU A to T change at nucleotide 427 resulting in a premature stop codon after threonine 142, predicted to delete two-thirds of the protein. Kimmel Lab ZDB-LAB-970408-13 Chr: 5 2019-09-17
ZDB-ALT-070306-4 b1112 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-070306-5 b1115 Point Mutation adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-060811-2 b1123 Unknown Crump Lab ZDB-LAB-060809-1 Unmapped 2019-09-17
ZDB-ALT-111017-3 b1125 Point Mutation adult females treated with ENU C1162T mutation in the seventh exon that changes aa388 from Gln to STOP, which deletes a highly conserved Cys residue at aa389. Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 20 2019-09-17
ZDB-ALT-080318-3 b1127 Point Mutation adult males treated with ENU T991C mutation in the sixth exon that changes a highly-conserved Cys to Arg at aa331. Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 20 2019-09-17
ZDB-ALT-080318-4 b1128 Point Mutation adult males treated with ENU Contains a G2103A splice donor mutation in the ninth exon, which forces usage of cryptic splice donors, typically causing a tetranucleotide insertion that frameshifts the coding sequence from aa702. Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 3 2019-09-17
ZDB-ALT-100526-4 b1130 Point Mutation ENU pif b1130 displayed a 7231G>T mutation in the fras1 coding region, resulting in a premature translational termination after amino acid residue 2410. (Carney et al. ZDB-PUB-100427-24 ) Kimmel Lab ZDB-LAB-970408-13 Chr: 5 2019-09-17
ZDB-ALT-111118-31 b1149 bmp4 C365S Point Mutation adult males treated with ENU Characterization of bmp4 C365S revealed an erratically penetrant ventral patterning defect, present at non-Mendelian ratio. Additional analysis confirmed that the C365S mutation has a partially penetrant dominant-negative effect. Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 17 2019-09-17
ZDB-ALT-111118-30 b1150 bmp4S355* Point Mutation adult males treated with ENU Characterization of bmp4 S355* revealed an erratically penetrant ventral patterning defect, present at non-Mendelian ratio. Additional analysis confirmed that the S355*
mutation has a partially penetrant dominant-negative effect. Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 17 2019-09-17
ZDB-ALT-161010-10 b1161 Indel adult males treated with ENU This lesion results in protein truncation after amino acid 845 of 1059 with the predicted addition of 21 aberrant
amino acids(EFTHWSWRPRLFRTLQSYWAS. Kimmel Lab ZDB-LAB-970408-13 Chr: 16 2019-09-17
ZDB-ALT-080318-5 b1166 Unknown adult males treated with ENU Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 25 2019-09-17
ZDB-ALT-111118-29 b1172 bmp4Y180*, Y180 Point Mutation adult males treated with ENU The bmp4Y180* allele, has a stop codon early in the prodomain, that truncates he Bmp4 protein prior to the carboxy-terminal activesignaling molecule. Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 17 2019-09-17
ZDB-ALT-080318-2 b1182 Unknown adult males treated with ENU Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 18 2019-09-17
ZDB-ALT-070124-3 b1184 Unknown touch response mutant Washbourne Lab ZDB-LAB-061030-1 Unmapped 2019-09-17
ZDB-ALT-111017-4 b1189 Point Mutation adult males treated with ENU T1600G mutation in the seventh exon that changes a highly-conserved Ser to Ala at aa534. Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 3 2019-09-17
ZDB-ALT-070430-3 b1193Tg Tg(hsp70:fgf8)b1193, Tg(hsp70l:fgf8)b1193 Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped Tg(hsp70l:fgf8a) ZDB-TGCONSTRCT-070427-1 2019-09-17
ZDB-ALT-080715-1 b1200Tg Tg(emx3:YFP)b1200 Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped Tg(emx3:YFP) ZDB-TGCONSTRCT-080715-1 2019-09-17
ZDB-ALT-080715-5 b1201Tg Tg(emx3:YFPm)b1201 Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped Tg(emx3:YFPm) ZDB-TGCONSTRCT-080715-2 2019-09-17
ZDB-ALT-080715-3 b1202Tg Tg(hsp70l:emx3-myc-GFP)b1202 Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped Tg(hsp70l:emx3-MYC-GFP) ZDB-TGCONSTRCT-080715-3 2019-09-17
ZDB-ALT-080715-4 b1203Tg Tg(emx3:emx3-myc-GFP)b1203 Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped Tg(emx3:emx3-MYC-GFP) ZDB-TGCONSTRCT-080715-4 2019-09-17
ZDB-ALT-100317-1 b1204Tg Tg(lhx5:Kaede)b1204 Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped TgBAC(lhx5:Kaede) ZDB-TGCONSTRCT-100317-1 2019-09-17
ZDB-ALT-100317-2 b1205Tg Tg(lhx5:GFP)b1205 Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped Tg(lhx5:GFP) ZDB-TGCONSTRCT-100317-2 2019-09-17
ZDB-ALT-100402-1 b1212Tg Tg(sp7:EGFP)b1212 Transgenic Insertion embryos treated with DNA Kimmel Lab ZDB-LAB-970408-13 Unmapped Tg(sp7:EGFP) ZDB-TGCONSTRCT-100402-2 2019-09-17
ZDB-ALT-130621-1 b1219 Point Mutation adult males treated with ENU Zigman et al (2014): b1219 carries a point mutation in the first exon of hoxb1b. The A-to-T transversion at position 274 leads to a premature stop codon at amino acid 92 (R92X) of this 307 amino acid protein, upstream of the essential DNA-binding homeobox motif. Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 12 2019-09-17
ZDB-ALT-120709-1 b1222Tg Tg(mnx1:Gal4-VP16)b1222 Transgenic Insertion embryos treated with DNA Washbourne Lab ZDB-LAB-061030-1 Unmapped Tg(mnx1:GAL4-VP16) ZDB-TGCONSTRCT-120709-1 2019-09-17
ZDB-ALT-140602-1 b1224Tg Transgenic Insertion embryos treated with DNA Eisen Lab ZDB-LAB-970408-42 Unmapped Tg(UAS:Tomato,myl7:EGFP) ZDB-TGCONSTRCT-140602-1 2019-09-17
ZDB-ALT-130814-3 b1228Tg Tg(hand2:Gal4-VP16)b1228 Transgenic Insertion embryos treated with DNA Kimmel Lab ZDB-LAB-970408-13 Unmapped Tg(hand2:GAL4-VP16) ZDB-TGCONSTRCT-130814-2 2019-09-17
ZDB-ALT-130814-4 b1229Tg Tg(UAS:Crimson,myl7:EGFP)b1229 Transgenic Insertion embryos treated with DNA Kimmel Lab ZDB-LAB-970408-13 Unmapped Tg(UAS:Crimson,myl7:EGFP) ZDB-TGCONSTRCT-130814-3 2019-09-17
ZDB-ALT-980203-591 b123 Unknown spontaneous No lesion was found in the coding sequence of this allele, but expression levels of cx43 are significantly reduced. Streisinger Lab ZDB-LAB-980209-8 Chr: 20 2019-09-17
ZDB-ALT-120803-1 b1230Tg Tg(dusp6:CreERT2,myl7:ECFP)b1230 Transgenic Insertion embryos treated with DNA Stankunas Lab ZDB-LAB-120618-1 Unmapped Tg(dusp6:Cre-ERT2,myl7:ECFP) ZDB-TGCONSTRCT-120803-1 2019-09-17
ZDB-ALT-131029-1 b1231Tg Tg(actc1b:Hpy.CagA-EGFP)b1231 Transgenic Insertion embryos treated with DNA Guillemin Lab ZDB-LAB-050228-1 Unmapped Tg(actc1b:Hpy.CagA-EGFP) ZDB-TGCONSTRCT-131029-1 2019-09-17
ZDB-ALT-131029-2 b1232Tg Tg(fabp2:Hpy.CagA-EGFP)b1232 Transgenic Insertion embryos treated with DNA Guillemin Lab ZDB-LAB-050228-1 Unmapped Tg(fabp2:Hpy.CagA-EGFP) ZDB-TGCONSTRCT-131029-3 2019-09-17
ZDB-ALT-131029-3 b1233Tg Tg(actc1b:Hpy.CagA_Y2684S_Y2741S-EGFP)b1233 Transgenic Insertion embryos treated with DNA Guillemin Lab ZDB-LAB-050228-1 Unmapped Tg(actc1b:Hpy.CagA_Y2684S_Y2741S-EGFP) ZDB-TGCONSTRCT-131029-2 2019-09-17
ZDB-ALT-140908-2 b1234Tg Transgenic Insertion embryos treated with DNA Stankunas Lab ZDB-LAB-120618-1 Unmapped Tg(krt5:GAL4-ERT2-VP16,myl7:ECFP) ZDB-TGCONSTRCT-140908-1 2019-09-17
ZDB-ALT-140908-3 b1235Tg Transgenic Insertion embryos treated with DNA Stankunas Lab ZDB-LAB-120618-1 Unmapped Tg(dusp6:GAL4-ERT2-VP16,myl7:ECFP) ZDB-TGCONSTRCT-140908-2 2019-09-17
ZDB-ALT-140908-4 b1236Tg Transgenic Insertion embryos treated with DNA Stankunas Lab ZDB-LAB-120618-1 Unmapped Tg(Xla.Eef1a1:GAL4-ERT2-VP16,myl7:ECFP) ZDB-TGCONSTRCT-140908-3 2019-09-17
ZDB-ALT-160428-2 b1237 Small Deletion embryos treated with TALEN1-dnmt3bb.1 Kimmel Lab ZDB-LAB-970408-13 Chr: 23 2019-09-17
ZDB-ALT-190314-4 b1240 13 bp deletion in exon 1 Small Deletion embryos treated with TALEN1-ush1ga Westerfield Lab ZDB-LAB-970408-1 Chr: 3 2019-09-17
ZDB-ALT-181023-1 b1245 Indel embryos treated with CRISPR3-ush2a ENSDART00000086201.4; c.15520_15523delinsTG; p.Ala5174fsTer,
predicted to encode an usherin protein that retains the transmembrane domain but lacks the C-terminal 62 amino acids of the intracellular region including the class I PDZ binding motif. Westerfield Lab ZDB-LAB-970408-1 Chr: 17 2019-09-17
ZDB-ALT-170306-1 b1246 Small Deletion embryos treated with CRISPR1-prrx1a Nichols Lab ZDB-LAB-170207-3 Chr: 2 2019-09-17
ZDB-ALT-170306-2 b1247 Small Deletion embryos treated with CRISPR1-prrx1b Nichols Lab ZDB-LAB-170207-3 Chr: 20 2019-09-17
ZDB-ALT-160810-3 b1250 Small Deletion embryos treated with CRISPR1-ubr3 Westerfield Lab ZDB-LAB-970408-1 Chr: 9 2019-09-17
ZDB-ALT-160810-4 b1251 Insertion embryos treated with CRISPR2-ubr3 Westerfield Lab ZDB-LAB-970408-1 Chr: 9 2019-09-17
ZDB-ALT-170126-7 b1252Tg Transgenic Insertion embryos treated with DNA Kimmel Lab ZDB-LAB-970408-13 Unmapped Tg(fli1a-hsp70l:NLS-mCherry) ZDB-TGCONSTRCT-170126-1 2019-09-17
ZDB-ALT-190402-2 b1259 Small Deletion embryos treated with CRISPR1-grxcr1a Westerfield Lab ZDB-LAB-970408-1 Chr: 14 2019-09-17
ZDB-ALT-980203-804 b126 Unknown embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-190402-4 b1260 Small Deletion embryos treated with CRISPR2-grxcr1a Westerfield Lab ZDB-LAB-970408-1 Chr: 14 2019-09-17
ZDB-ALT-160503-12 b1278Tg Transgenic Insertion embryos treated with DNA Washbourne Lab ZDB-LAB-061030-1 Unmapped Tg(4xnrUAS:HA-Tgo.Uprt-mCherry) ZDB-TGCONSTRCT-160503-13 2019-09-17
ZDB-ALT-180315-3 b1279 8-nucleotide deletion Indel embryos treated with TALEN1-gsdf Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 21 2019-09-17
ZDB-ALT-180315-2 b1280 1-nucleotide deletion Small Deletion embryos treated with TALEN1-gsdf Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 21 2019-09-17
ZDB-ALT-180315-4 b1281 14-nucleotide deletion Small Deletion embryos treated with TALEN1-gsdf Postlethwait Zebrafish Genetics Laboratory ZDB-LAB-970408-67 Chr: 21 2019-09-17
ZDB-ALT-181112-9 b1282 Small Deletion embryos treated with CRISPR1-edn3a Eisen Lab ZDB-LAB-970408-42 Chr: 11 2019-09-17
ZDB-ALT-181112-10 b1283 Indel embryos treated with CRISPR1-edn3b Eisen Lab ZDB-LAB-970408-42 Chr: 23 2019-09-17
ZDB-ALT-980203-558 b130 Unknown embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-180418-1 b1307 Small Deletion embryos treated with CRISPR4-kdm6bb A 40 bp deletion that spans the first 14 bp of exon 15 introduces an early stop codon. The predicted truncated protein would lack the entire JmjC domain. Stankunas Lab ZDB-LAB-120618-1 Chr: 10 2019-09-17
ZDB-ALT-180418-2 b1308 Small Deletion embryos treated with CRISPR1-kdm6ba The predicted truncated protein lacks the JmjC domain. Stankunas Lab ZDB-LAB-120618-1 Chr: 7 2019-09-17
ZDB-ALT-190913-1 b1311 Small Deletion embryos treated with CRISPR1-cog4 Westerfield Lab ZDB-LAB-970408-1 Chr: 7 2019-09-17
ZDB-ALT-190712-1 b1312 Small Deletion embryos treated with CRISPR2-cog4 13 bp deletion in exon 12 Westerfield Lab ZDB-LAB-970408-1 Chr: 7 2019-09-17
ZDB-ALT-190402-5 b1319Tg Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped Tg(myo6b:KDEL-Crimson) ZDB-TGCONSTRCT-190402-2 2019-09-17
ZDB-ALT-980203-310 b134 Unknown embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 20 2019-09-17
ZDB-ALT-190314-3 b1342 10 bp deletion in exon 2 Small Deletion embryos treated with CRISPR1-ush1ga Westerfield Lab ZDB-LAB-970408-1 Chr: 3 2019-09-17
ZDB-ALT-180404-5 b1345Tg Transgenic Insertion embryos treated with DNA Eisen Lab ZDB-LAB-970408-42 Unmapped Tg(10xUAS:LOXP-LOX2272-Tomato-LOXP-EGFP-LOX2272-Crimson,myl7:EGFP) ZDB-TGCONSTRCT-180404-3 2019-09-17
ZDB-ALT-190724-6 b1347 Small Deletion embryos treated with CRISPR1-tonsl Westerfield Lab ZDB-LAB-970408-1 Chr: 17 2019-09-17
ZDB-ALT-190724-7 b1348 Small Deletion embryos treated with CRISPR1-tonsl Westerfield Lab ZDB-LAB-970408-1 Chr: 17 2019-09-17
ZDB-ALT-190328-3 b1367 Indel Adam C Miller Lab ZDB-LAB-160115-2 Chr: 10 2019-09-17
ZDB-ALT-190328-4 b1368 Small Deletion embryos treated with CRISPR Adam C Miller Lab ZDB-LAB-160115-2 Chr: 8 2019-09-17
ZDB-ALT-190328-5 b1369 Indel embryos treated with CRISPR Adam C Miller Lab ZDB-LAB-160115-2 Chr: 22 2019-09-17
ZDB-ALT-190502-1 b1370 Indel embryos treated with CRISPR1-tjp1b Adam C Miller Lab ZDB-LAB-160115-2 Chr: 25 2019-09-17
ZDB-ALT-980203-590 b140 Unknown spontaneous Kimmel Lab ZDB-LAB-970408-13 Chr: 1 2019-09-17
ZDB-ALT-980203-368 b146 Unknown embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-980203-339 b153 Unknown embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-970730-11 b160 Insertion embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 19 2019-09-17
ZDB-ALT-980203-389 b163 Unknown embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-020506-2 b165Tg b165, Tg(Hsp70-1:lacz), Tg(Hsp70-1:lacz)b165 Transgenic Insertion embryos treated with DNA Westerfield Lab ZDB-LAB-970408-1 Unmapped Tg(Hsp70-1:lacz) ZDB-TGCONSTRCT-070117-134 2019-09-17
ZDB-ALT-980203-332 b18 (part of) Sheer fish, when combined with b4, transparent Small Deletion spontaneous This is the transparent mutant referred to in Krauss et al. (2013). Streisinger Lab ZDB-LAB-980209-8 Ambiguous 2019-09-17
ZDB-ALT-980203-400 b188 Translocation embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-980203-401 b191 Unknown spontaneous Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-970731-39 b195 Insertion spontaneous Spontaneous out of golden (gol-1). Kimmel Lab ZDB-LAB-970408-13 Chr: 19 2019-09-17
ZDB-ALT-980203-402 b2 Unknown spontaneous Formerly golden-2, renamed brass (brs) to avoid confusion with golden-1. Streisinger Lab ZDB-LAB-980209-8 Chr: 13 2019-09-17
ZDB-ALT-980203-342 b201 Unknown embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-980203-337 b204 Translocation embryos treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 18 2019-09-17
ZDB-ALT-980203-331 b212 Unknown adult males treated with ENU Kimmel Lab ZDB-LAB-970408-13 Chr: 8 2019-09-17
ZDB-ALT-980203-494 b214 Unknown sperm treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-010413-2 b215 Unknown g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 15 2019-09-17
ZDB-ALT-980203-309 b217 Unknown sperm treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-980203-343 b222 Unknown sperm treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Unmapped 2019-09-17
ZDB-ALT-980203-604 b257 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Chr: 1 2019-09-17
ZDB-ALT-980203-495 b258 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-812 b259 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-308 b260 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-305 b261 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-303 b262 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-312 b263 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-323 b264 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-324 b265 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-302 b266 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-328 b267 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-329 b268 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-344 b269 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-306 b270 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-330 b273 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-301 b274 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-333 b275 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Unmapped 2019-09-17
ZDB-ALT-980203-367 b286 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-980203-800 b300 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-980203-364 b302 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-991208-40 b305 Translocation sperm treated with g-rays b305 b386b409 c4 and c47 are overlapping deficiencies affecting the cerebum (crm) locus. Balanced translocation with c113. Halpern Lab ZDB-LAB-980205-5 Unmapped 2019-09-17
ZDB-ALT-991130-42 b333 b333, Df(LG08:tbx16), Df(LG08:tbx16)b333 Small Deletion g-rays exon 4 (therefore 3' end of gene) of slc25a37 appears to be missing in b333 mutants Halpern Lab ZDB-LAB-980205-5 Ambiguous 2019-09-17
ZDB-ALT-970731-16 b337 Point Mutation adult males treated with ENU Null allele (nonsense mutation in ORF). Kimmel Lab ZDB-LAB-970408-13 Chr: 23 2019-09-17
ZDB-ALT-980203-370 b369 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-980203-813 b374 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-980203-603 b382 Point Mutation adult males treated with ENU This mutant harbors a T to G transversion in the intron flanking exon 5. This creates a new splice acceptor site, resulting in the insertion of 3 additional amino acids in a highly conserved motif. Eisen Lab ZDB-LAB-970408-42 Chr: 19 2019-09-17
ZDB-ALT-991208-35 b386 Translocation sperm treated with g-rays b305 b386 b409 c4 and c47 are overlapping deficiencies affecting the cerebum (crm) locus. Balanced translocation with c111. Westerfield Lab ZDB-LAB-970408-1 Unmapped 2019-09-17
ZDB-ALT-980203-307 b39 b39rl Unknown adult males treated with g-rays Streisinger Lab ZDB-LAB-980209-8 Unmapped 2019-09-17
ZDB-ALT-980203-361 b392 Point Mutation adult males treated with ENU helixb392 is a strong allele of chameleon. Eisen Lab ZDB-LAB-970408-42 Chr: 20 2019-09-17
ZDB-ALT-980203-313 b393 Complex adult males treated with ENU b393 has three point mutations - A2410G (L763R), C2739T (R873stop) and T2826C (L903H). b393 is homozygous viable. Heterozygotes exhibit a mild phenotype, suggesting that the mutation acts as a partial dominant. Eisen Lab ZDB-LAB-970408-42 Chr: 13 2019-09-17
ZDB-ALT-990423-32 b398 Unknown Eisen Lab ZDB-LAB-970408-42 Chr: 13 2019-09-17
ZDB-ALT-980203-365 b4 (part of) Crystal fish, (part of) Sheer fish Insertion spontaneous spontaneous transposon insertion Streisinger Lab ZDB-LAB-980209-8 Chr: 21 2019-09-17
ZDB-ALT-980203-493 b404 Unknown sperm treated with g-rays Kimmel Lab ZDB-LAB-970408-13 Chr: 14 2019-09-17
ZDB-ALT-990427-7 b420 Point Mutation nucleotide change: T to A,
sequence surrounding change: gccttAagtgt,
mutated amino acid: K to STOP,
loose ends was found to be an allele of deadly seven by complementation.
Eisen Lab ZDB-LAB-970408-42 Chr: 21 2019-09-17
ZDB-ALT-110124-2 b426 Unknown adult males treated with ENU b426 was never sequenced so it is not known for certain that the ENU mutagenesis produced a point mutation. Westerfield Lab ZDB-LAB-970408-1 Chr: 12 2019-09-17
ZDB-ALT-980203-557 b431 b403 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-980203-471 b45 Unknown embryos treated with g-rays Streisinger Lab ZDB-LAB-980209-8 Unmapped 2019-09-17
ZDB-ALT-990423-37 b458 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Chr: 24 2019-09-17
ZDB-ALT-090205-3 b459 Unknown Kimmel Lab ZDB-LAB-970408-13 Chr: 19 2019-09-17
ZDB-ALT-010426-2 b460 Point Mutation In tst b460, T is changed to G at the 5’ splice site of the 4th intron of sf3b1. Halpern Lab ZDB-LAB-980205-5 Chr: 9 2019-09-17
ZDB-ALT-000712-2 b476 moe Small Deletion sperm treated with g-rays mutation is recessive lethal (homozygous embryos die around 6 dpf) Westerfield Lab ZDB-LAB-970408-1 Chr: 9 2019-09-17
ZDB-ALT-030421-2 b480 Unknown Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-090205-2 b487 Unknown Kimmel Lab ZDB-LAB-970408-13 Chr: 19 2019-09-17
ZDB-ALT-980203-325 b5 Small Deletion spontaneous Streisinger Lab ZDB-LAB-980209-8 Chr: 20 2019-09-17
ZDB-ALT-041111-4 b508 Small Deletion adult males treated with ENU Sequencing of b508 reveals a 68 nucleotide deletion (aa 1410-1432) comprising a single exon and resulting in a frameshift, 16 novel amino acids, and a premature stop codon. Analyses of genomic DNA reveal a deletion corresponding to one exon in addition to parts of flanking introns. Eisen Lab ZDB-LAB-970408-42 Chr: 18 2019-09-17
ZDB-ALT-030327-2 b557 Point Mutation Kimmel Lab ZDB-LAB-970408-13 Chr: 3 2019-09-17
ZDB-ALT-990422-78 b577 Point Mutation adult males treated with ENU Westerfield Lab ZDB-LAB-970408-1 Ambiguous 2019-09-17
ZDB-ALT-980303-41 b590 Unknown spontaneous Westerfield Lab ZDB-LAB-970408-1 Chr: 20 2019-09-17
ZDB-ALT-011017-20 b593 Unknown ENU Westerfield Lab ZDB-LAB-970408-1 Chr: 13 2019-09-17
ZDB-ALT-980413-368 b6 Unknown If you are looking for the transparent mutant, see b18. transparent was referred to as b6 in Krauss et. al (2013), but this was in error. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 18 2019-09-17
ZDB-ALT-030323-2 b631 Point Mutation Kimmel Lab ZDB-LAB-970408-13 Chr: 10 2019-09-17
ZDB-ALT-051214-10 b638 Unknown adult males treated with ENU Amacher Lab ZDB-LAB-001018-2 Chr: 21 2019-09-17
ZDB-ALT-040405-2 b639 Unknown sperm treated with ENU Kimmel Lab ZDB-LAB-970408-13 Chr: 14 2019-09-17
ZDB-ALT-000821-2 b641 Point Mutation adult males treated with ENU Westerfield Lab ZDB-LAB-970408-1 Ambiguous 2019-09-17
ZDB-ALT-051214-8 b663 Unknown Amacher Lab ZDB-LAB-001018-2 Chr: 15 2019-09-17
ZDB-ALT-010919-2 b692 Point Mutation David Raible Lab ZDB-LAB-980202-1 Chr: 6 2019-09-17
ZDB-ALT-040701-2 b700 Small Deletion ENU In b700, a 22 bp deletion in the third exon results in a frame-shift that leads to a stop codon after the second LIM domain. Westerfield Lab ZDB-LAB-970408-1 Chr: 8 2019-09-17
ZDB-ALT-040601-2 b719 Small Deletion embryos treated with ENU One bp (cytosine) is deleted in exon 14. Kimmel Lab ZDB-LAB-970408-13 Chr: 5 2019-09-17
ZDB-ALT-041111-2 b722 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Chr: 18 2019-09-17
ZDB-ALT-091203-1 b756 Unknown adult males treated with ENU Homozygous viable. Fish have no yellow pigment. There are normal numbers of xanthopore precursors but there is no pteridine synthesis. Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-091203-2 b758 Unknown ENU Homozygous viable. Fish have no yellow pigment. There are normal numbers of xanthopore precursors but there is no pteridine synthesis. Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-090904-1 b765 Unknown Kimmel Lab ZDB-LAB-970408-13 Chr: 24 2019-09-17
ZDB-ALT-001213-2 b781 Point Mutation adult males treated with ENU Westerfield Lab ZDB-LAB-970408-1 Chr: 9 2019-09-17
ZDB-ALT-010911-2 b817 Unknown sperm treated with ENU Does not complement nic-1 Eisen Lab ZDB-LAB-970408-42 Chr: 6 2019-09-17
ZDB-ALT-020511-2 b864 Unknown Westerfield Lab ZDB-LAB-970408-1 Unmapped 2019-09-17
ZDB-ALT-070117-21 b871 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-070306-6 b875 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-040519-2 b882 Point Mutation The change predicts a transcript that retains intron 5 with a stop codon 84 base pairs into the intron. This results in a truncated protein with 27 missense amino acids at the carboxy terminus. Westerfield Lab ZDB-LAB-970408-1 Chr: 9 2019-09-17
ZDB-ALT-070306-7 b896 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-040930-24 b926 Point Mutation ENU Kimmel Lab ZDB-LAB-970408-13 Chr: 23 2019-09-17
ZDB-ALT-080925-12 b943 Point Mutation adult males treated with ENU Kimmel Lab ZDB-LAB-970408-13 Chr: 8 2019-09-17
ZDB-ALT-070306-8 b953 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-060822-4 b963 Point Mutation ENU Kimmel Lab ZDB-LAB-970408-13 Chr: 7 2019-09-17
ZDB-ALT-070306-9 b984 Unknown adult males treated with ENU Eisen Lab ZDB-LAB-970408-42 Unmapped 2019-09-17
ZDB-ALT-040601-4 b999 Point Mutation embryos treated with ENU A C-to-T missense mutation introduces an early stop codon in the 16th exon. Kimmel Lab ZDB-LAB-970408-13 Chr: 5 2019-09-17
ZDB-ALT-121128-3 ba101Tg Tg(-4.7sox10:Cre)ba101 Transgenic Insertion embryos treated with DNA Bath Zebrafish Development Lab ZDB-LAB-970905-1 Unmapped Tg(-4.7sox10:Cre) ZDB-TGCONSTRCT-121128-1 2019-09-17
ZDB-ALT-050913-4 ba2Tg ba2, Tg(-4.9sox10:EGFP), Tg(-4.9sox10:EGFP)ba2 Transgenic Insertion embryos treated with DNA Bath Zebrafish Development Lab ZDB-LAB-970905-1 Unmapped Tg(-4.9sox10:EGFP) ZDB-TGCONSTRCT-070117-69 2019-09-17
ZDB-ALT-090819-1 ba3Tg Tg(-4725sox10:GFP)ba3 Transgenic Insertion embryos treated with DNA Kelsh lab Bath Zebrafish Development Lab ZDB-LAB-970905-1 Unmapped Tg(-4.7sox10:GFP) ZDB-TGCONSTRCT-090819-1 2019-09-17
ZDB-ALT-090819-2 ba4Tg Tg(-4725sox10:GFP)ba4 Transgenic Insertion embryos treated with DNA Kelsh lab Bath Zebrafish Development Lab ZDB-LAB-970905-1 Unmapped Tg(-4.7sox10:GFP) ZDB-TGCONSTRCT-090819-1 2019-09-17
ZDB-ALT-090819-3 ba5Tg Tg(-1252sox10:GFP)ba5 Transgenic Insertion embryos treated with DNA Kelsh lab Bath Zebrafish Development Lab ZDB-LAB-970905-1 Unmapped Tg(-1.25sox10:GFP) ZDB-TGCONSTRCT-090819-2 2019-09-17
ZDB-ALT-171108-1 ba6 Small Deletion embryos treated with CRISPR2-tfec WT accession no: XM_017355023; Chromosome 4; Mutation in exon 7; Deletion point: 6,035,834 nucleotides; Sequence: aacaaagggacgatcctcaa[ggcctc]ggtggaata (deleted nucleotides in square brackets) Bath Zebrafish Development Lab ZDB-LAB-970905-1 Chr: 4 2019-09-17
ZDB-ALT-121128-1 ba73Tg Tg(-4.7sox10:Cre)ba73 Transgenic Insertion embryos treated with DNA Bath Zebrafish Development Lab ZDB-LAB-970905-1 Unmapped Tg(-4.7sox10:Cre) ZDB-TGCONSTRCT-121128-1 2019-09-17
ZDB-ALT-121128-2 ba74Tg Tg(-4.7sox10:Cre)ba74 Transgenic Insertion embryos treated with DNA Bath Zebrafish Development Lab ZDB-LAB-970905-1 Unmapped Tg(-4.7sox10:Cre) ZDB-TGCONSTRCT-121128-1 2019-09-17
ZDB-ALT-101008-1 barx1_unrecovered unrec_barx1, unrecovered_barx1 Point Mutation adult males treated with ENU Chr: 11 2019-09-17
ZDB-ALT-070131-1 baz1 Point Mutation adult males treated with ENU Bath Zebrafish Development Lab ZDB-LAB-970905-1 Chr: 3 2019-09-17
ZDB-ALT-120313-1 bc1Tg Tg(hsp70l:Gal80-MYC)bc1 Transgenic Insertion embryos treated with DNA Lopez-Schier Lab ZDB-LAB-061020-1 Unmapped Tg(hsp70l:GAL80-MYC) ZDB-TGCONSTRCT-120313-1 2019-09-17
ZDB-ALT-120313-2 bc2Tg Tg(UAS:MA-Tomato)bc2 Transgenic Insertion embryos treated with DNA Lopez-Schier Lab ZDB-LAB-061020-1 Unmapped Tg(UAS:MA-Tomato) ZDB-TGCONSTRCT-120313-2 2019-09-17
ZDB-ALT-120424-6 bc3Tg Tg(hsp70l:mCherry-2.0cntnap2a)bc3, Tg(SILL1) Transgenic Insertion embryos treated with DNA Lopez-Schier Lab ZDB-LAB-061020-1 Unmapped Tg(hsp70l:mCherry-2.0cntnap2a) ZDB-TGCONSTRCT-120424-6 2019-09-17
ZDB-ALT-120424-7 bc4Tg Tg(hsp70l:Gal4-VP16-2.0cntnap2a)bc4, Tg(SILL2) Transgenic Insertion embryos treated with DNA Lopez-Schier Lab ZDB-LAB-061020-1 Unmapped Tg(hsp70l:GAL4-VP16-2.0cntnap2a) ZDB-TGCONSTRCT-120424-7 2019-09-17
ZDB-ALT-150504-6 bc5Tg Transgenic Insertion embryos treated with DNA Lopez-Schier Lab ZDB-LAB-061020-1 Unmapped Tg(pou4f3:ctbp2l-mKOFP) ZDB-TGCONSTRCT-150504-8 2019-09-17
ZDB-ALT-180530-14 bcz11 Small Deletion embryos treated with CRISPR1-foxq1a, CRISPR2-foxq1a, CRISPR3-foxq1a Shiau Lab ZDB-LAB-150914-3 Chr: 2 2019-09-17
ZDB-ALT-180530-15 bcz18 Indel embryos treated with CRISPR1-foxq1b, CRISPR2-foxq1b, CRISPR3-foxq1b Shiau Lab ZDB-LAB-150914-3 Chr: 20 2019-09-17
ZDB-ALT-120515-3 bcz1Tg Tg(lmo1-E1b:EGFP)bcz1 Transgenic Insertion embryos treated with DNA Chuang Lab ZDB-LAB-101015-1 Unmapped Tg(lmo1-E1B:EGFP) ZDB-TGCONSTRCT-120515-2 2019-09-17
ZDB-ALT-120515-4 bcz2Tg Tg(lmo1-E1b:EGFP)bcz2 Transgenic Insertion embryos treated with DNA Chuang Lab ZDB-LAB-101015-1 Unmapped Tg(lmo1-E1B:EGFP) ZDB-TGCONSTRCT-120515-2 2019-09-17
ZDB-ALT-120515-5 bcz3Tg Tg(lmo1-E1b:EGFP)bcz3 Transgenic Insertion embryos treated with DNA Chuang Lab ZDB-LAB-101015-1 Unmapped Tg(lmo1-E1B:EGFP) ZDB-TGCONSTRCT-120515-2 2019-09-17
ZDB-ALT-120515-6 bcz4Tg Tg(lmo1-E1b:EGFP)bcz4 Transgenic Insertion embryos treated with DNA Chuang Lab ZDB-LAB-101015-1 Unmapped Tg(lmo1-E1B:EGFP) ZDB-TGCONSTRCT-120515-2 2019-09-17
ZDB-ALT-070228-1 be1324 Mut.1324 Unknown ENU Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped 2019-09-17
ZDB-ALT-110408-1 be1Tg Tg(-1myl7:ERT2CreERT2-IRES-mCherry)be1 Transgenic Insertion embryos treated with DNA Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped Tg(-1myl7:ERT2-Cre-ERT2-IRES-mCherry) ZDB-TGCONSTRCT-110408-1 2019-09-17
ZDB-ALT-110408-2 be2Tg Tg(-1myl7:loxP-STOP-loxP-EGFP)be2 Transgenic Insertion embryos treated with DNA Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped Tg(-1myl7:LOXP-STOP-LOXP-EGFP) ZDB-TGCONSTRCT-110408-2 2019-09-17
ZDB-ALT-120608-1 be3Tg Tg(kdrl:copGFP)be3 Transgenic Insertion embryos treated with DNA Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped Tg(kdrl:copGFP) ZDB-TGCONSTRCT-120608-2 2019-09-17
ZDB-ALT-120608-2 be4Tg Tg(myl7:copGFP)be4 Transgenic Insertion embryos treated with DNA Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped Tg(myl7:copGFP) ZDB-TGCONSTRCT-120608-1 2019-09-17
ZDB-ALT-121008-3 be5Tg Tg(myl7:LOXP-RFP-LOXP-Mmu.dnMapk14)be5 Transgenic Insertion embryos treated with DNA Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped Tg(myl7:LOXP-RFP-LOXP-Mmu.dnMapk14) ZDB-TGCONSTRCT-121008-2 2019-09-17
ZDB-ALT-121008-4 be6Tg Tg(myl7:LOXP-RFP-LOXP-Hsa.MAP2K6)be6 Transgenic Insertion embryos treated with DNA Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped Tg(myl7:LOXP-RFP-LOXP-Hsa.MAP2K6) ZDB-TGCONSTRCT-121008-3 2019-09-17
ZDB-ALT-140214-1 be7Tg Tg(myl7:LOXP-RFP-LOXP,dnhif1ab)be7 Transgenic Insertion embryos treated with DNA Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped Tg(myl7:LOXP-RFP-LOXP,dnhif1ab) ZDB-TGCONSTRCT-140214-1 2019-09-17
ZDB-ALT-140214-2 be8Tg Tg(myl7:ERT2-CreERT2)be8 Transgenic Insertion embryos treated with DNA Izpisúa Belmonte Lab ZDB-LAB-020725-2 Unmapped Tg(myl7:ERT2-Cre-ERT2) ZDB-TGCONSTRCT-140214-2 2019-09-17
ZDB-ALT-190823-2 bgu1 Z14 Indel embryos treated with CRISPR2-map11, CRISRP1-map11 Birnbaum Lab ZDB-LAB-190820-1 Chr: 7 2019-09-17
ZDB-ALT-190823-3 bgu2 Z17 Indel embryos treated with CRISPR2-map11, CRISRP1-map11 Birnbaum Lab ZDB-LAB-190820-1 Chr: 7 2019-09-17
ZDB-ALT-110722-28 bi100Tg Tg(5Hsa.PAX6-gata2a:EGFP)bi100 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg5(Hsa.PAX6-gata2a:EGFP) ZDB-TGCONSTRCT-110722-25 2019-09-17
ZDB-ALT-110722-29 bi101Tg Tg(6Hsa.PAX6-gata2a:EGFP)bi101 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg6(Hsa.PAX6-gata2a:EGFP) ZDB-TGCONSTRCT-110722-26 2019-09-17
ZDB-ALT-110722-31 bi102Tg Tg(4pax6a-gata2a:EGFP)bi102 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg4(pax6a-gata2a:EGFP) ZDB-TGCONSTRCT-110722-27 2019-09-17
ZDB-ALT-110722-32 bi103Tg Tg(4pax6b-gata2a:EGFP)bi103 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(pax6b-gata2a:EGFP) ZDB-TGCONSTRCT-110722-28 2019-09-17
ZDB-ALT-110722-33 bi104Tg Tg(7Hsa.PAX6-gata2a:EGFP)bi104 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg7(Hsa.PAX6-gata2a:EGFP) ZDB-TGCONSTRCT-110722-29 2019-09-17
ZDB-ALT-120124-1 bi105Tg TgIXtr.Hhex-gata2a:EGFP)bi105, Tg(Xtr.Hhex-gata2a:EGFP)bi105 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Xtr.Hhex-gata2a:EGFP) ZDB-TGCONSTRCT-120124-1 2019-09-17
ZDB-ALT-120124-2 bi106Tg Tg(Hsa.SOX4-gata2a:EGFP)bi106 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Hsa.SOX4-gata2a:EGFP) ZDB-TGCONSTRCT-120124-2 2019-09-17
ZDB-ALT-120124-3 bi107Tg Tg(Hsa.IRX3.1-gata2a:EGFP)bi107 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(Hsa.IRX3-gata2a:EGFP) ZDB-TGCONSTRCT-120124-3 2019-09-17
ZDB-ALT-120124-4 bi108Tg Tg(Hsa.IRX3.2-gata2a:EGFP)bi108 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Hsa.IRX3-gata2a:EGFP) ZDB-TGCONSTRCT-120124-4 2019-09-17
ZDB-ALT-120124-5 bi109Tg Tg(Hsa.IRX3.3-gata2a:EGFP)bi109 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg3(Hsa.IRX3-gata2a:EGFP) ZDB-TGCONSTRCT-120124-5 2019-09-17
ZDB-ALT-110131-10 bi10Tg Tg(fgf8a.10:GFP)bi10 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg10(fgf8a:GFP) ZDB-TGCONSTRCT-110131-10 2019-09-17
ZDB-ALT-120124-6 bi110Tg Tg(Hsa.IRX3.4-gata2a:EGFP)bi110 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg4(Hsa.IRX3-gata2a:EGFP) ZDB-TGCONSTRCT-120124-6 2019-09-17
ZDB-ALT-120124-7 bi111Tg STX-1X-1-A, Tg(Eca.Stx17.1-gata2a:EGFP)bi111 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(Eca.Stx17-gata2a:EGFP) ZDB-TGCONSTRCT-120124-7 2019-09-17
ZDB-ALT-120124-8 bi112Tg STX17-1X-2-B, Tg(Eca.Stx17.1-gata2a:EGFP)bi112 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Eca.Stx17-gata2a:EGFP) ZDB-TGCONSTRCT-120124-8 2019-09-17
ZDB-ALT-120124-9 bi113Tg STX17-1X-3-A, Tg(Eca.Stx17.1-gata2a:EGFP)bi113 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(Eca.Stx17-gata2a:EGFP) ZDB-TGCONSTRCT-120124-7 2019-09-17
ZDB-ALT-120124-10 bi114Tg STX17-1X-4-A, Tg(Eca.Stx17.1-gata2a:EGFP)bi114 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(Eca.Stx17-gata2a:EGFP) ZDB-TGCONSTRCT-120124-7 2019-09-17
ZDB-ALT-120124-11 bi115Tg STX17-DUP-2-A, Tg(Eca.Stx17.2-gata2a:EGFP)bi115 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Eca.Stx17-gata2a:EGFP) ZDB-TGCONSTRCT-120124-8 2019-09-17
ZDB-ALT-120124-12 bi116Tg STX17-DUP-3-A, Tg(Eca.Stx17.2-gata2a:EGFP)bi116 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Eca.Stx17-gata2a:EGFP) ZDB-TGCONSTRCT-120124-8 2019-09-17
ZDB-ALT-120124-13 bi117Tg STX17-DUP-4-A, Tg(Eca.Stx17.2-gata2a:EGFP)bi117 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Eca.Stx17-gata2a:EGFP) ZDB-TGCONSTRCT-120124-8 2019-09-17
ZDB-ALT-120124-14 bi118Tg STX17-DUP-4-B, Tg(Eca.Stx17.2-gata2a:EGFP)bi118 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Eca.Stx17-gata2a:EGFP) ZDB-TGCONSTRCT-120124-8 2019-09-17
ZDB-ALT-120626-1 bi119Tg Tg(1mir9-2-gata2a:EGFP)bi119 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(mir9-2-gata2a:EGFP) ZDB-TGCONSTRCT-120626-1 2019-09-17
ZDB-ALT-110131-11 bi11Tg Tg(fgf8a.11:GFP)bi11 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg11(fgf8a:GFP) ZDB-TGCONSTRCT-110131-11 2019-09-17
ZDB-ALT-130725-1 bi120Tg Tg(Hsa.ARX-gata2a:EGFP)bi120 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Hsa.ARX-gata2a:EGFP) ZDB-TGCONSTRCT-130724-2 2019-09-17
ZDB-ALT-160824-1 bi121Tg Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(actb2:mCherry-10xbsmir137) ZDB-TGCONSTRCT-160824-1 2019-09-17
ZDB-ALT-160824-2 bi122Tg Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(11xUAS:YFP-Hsa.MIR137,myl7:mCherry) ZDB-TGCONSTRCT-160824-5 2019-09-17
ZDB-ALT-160912-1 bi123Tg Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Hsa.SLIT3-hs1:GFP) ZDB-TGCONSTRCT-160912-3 2019-09-17
ZDB-ALT-160912-2 bi124Tg Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Hsa.SLIT3-hs2:GFP) ZDB-TGCONSTRCT-160912-2 2019-09-17
ZDB-ALT-160912-3 bi125Tg Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Hsa.SLIT2-hs1:GFP) ZDB-TGCONSTRCT-160912-4 2019-09-17
ZDB-ALT-161004-3 bi126Tg Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg(slit3:GFP) ZDB-TGCONSTRCT-161004-4 2019-09-17
ZDB-ALT-161004-4 bi127Tg Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(slit3:GFP) ZDB-TGCONSTRCT-161004-5 2019-09-17
ZDB-ALT-161116-2 bi128Tg SEN:GFP Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Et2(gata2a:EGFP) ZDB-ETCONSTRCT-161116-2 2019-09-17
ZDB-ALT-161116-3 bi129Tg Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg6(elavl3:GAL4-VP16) ZDB-TGCONSTRCT-161116-2 2019-09-17
ZDB-ALT-110131-12 bi12Tg Tg(fgf8a.12:GFP)bi12 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg12(fgf8a:GFP) ZDB-TGCONSTRCT-110131-12 2019-09-17
ZDB-ALT-110131-13 bi13Tg Tg(fgf8a.13:GFP)bi13 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg13(fgf8a:GFP) ZDB-TGCONSTRCT-110131-13 2019-09-17
ZDB-ALT-110131-14 bi14Tg Tg(fgf8a.14:GFP)bi14 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg14(fgf8a:GFP) ZDB-TGCONSTRCT-110131-14 2019-09-17
ZDB-ALT-110131-15 bi15Tg Tg(fgf8a.15:GFP)bi15 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg15(fgf8a:GFP) ZDB-TGCONSTRCT-110131-15 2019-09-17
ZDB-ALT-110131-16 bi16Tg Tg(fgf8a.16:GFP)bi16 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg16(fgf8a:GFP) ZDB-TGCONSTRCT-110131-16 2019-09-17
ZDB-ALT-110131-17 bi17Tg Tg(fgf8a.17:GFP)bi17 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg17(fgf8a:GFP) ZDB-TGCONSTRCT-110131-17 2019-09-17
ZDB-ALT-110131-18 bi18Tg Tg(fgf8a.18:GFP)bi18 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg18(fgf8a:GFP) ZDB-TGCONSTRCT-110131-18 2019-09-17
ZDB-ALT-110131-19 bi19Tg Tg(fgf8a.19:GFP)bi19 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg19(Hsa.FGF8:GFP) ZDB-TGCONSTRCT-110131-19 2019-09-17
ZDB-ALT-110131-1 bi1Tg Tg(fgf8a.1:GFP)bi1 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(fgf8a:GFP) ZDB-TGCONSTRCT-110131-1 2019-09-17
ZDB-ALT-110131-21 bi20Tg Tg(fgf8a.20:GFP)bi20 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg20(fgf8a:GFP) ZDB-TGCONSTRCT-110131-21 2019-09-17
ZDB-ALT-110131-22 bi21Tg Tg(fgf8a.21:GFP)bi21 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg21(fgf8a:GFP) ZDB-TGCONSTRCT-110131-22 2019-09-17
ZDB-ALT-110131-23 bi22Tg Tg(fgf8a.22:GFP)bi22 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg22(fgf8a:GFP) ZDB-TGCONSTRCT-110131-23 2019-09-17
ZDB-ALT-110127-8 bi23Tg hs 0, Tg(0Hsa.SOX11-gata2a:GFP)bi23 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(H0Hsa.SOX11-gata2a:GFP) ZDB-TGCONSTRCT-110127-6 2019-09-17
ZDB-ALT-110127-9 bi24Tg hs 2, Tg(2Hsa.SOX11-gata2a:GFP)bi24 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(H2Hsa.SOX11-gata2a:GFP) ZDB-TGCONSTRCT-110127-7 2019-09-17
ZDB-ALT-110127-10 bi25Tg dr B2, Tg(2sox11b-gata2a:GFP)bi25 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(B2sox11b-gata2a:GFP) ZDB-TGCONSTRCT-110127-8 2019-09-17
ZDB-ALT-110127-11 bi26Tg hs 3, Tg(3Hsa.SOX11-gata2a:GFP)bi26 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(H3Hsa.SOX11-gata2a:GFP) ZDB-TGCONSTRCT-110127-9 2019-09-17
ZDB-ALT-110127-12 bi27Tg dr A3, Tg(3sox11a-gata2a:GFP)bi27 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(A3sox11a-gata2a:GFP) ZDB-TGCONSTRCT-110127-10 2019-09-17
ZDB-ALT-110127-13 bi28Tg hs 5, Tg(5Hsa.SOX11-gata2a:GFP)bi28 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(H5Hsa.SOX11-gata2a:GFP) ZDB-TGCONSTRCT-110127-11 2019-09-17
ZDB-ALT-110127-14 bi29Tg dr A5, Tg(5sox11a-gata2a:GFP)bi29 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(A5sox11a-gata2a:GFP) ZDB-TGCONSTRCT-110127-12 2019-09-17
ZDB-ALT-110131-2 bi2Tg Tg(fgf8a.2:GFP)bi2 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(fgf8a:GFP) ZDB-TGCONSTRCT-110131-2 2019-09-17
ZDB-ALT-110127-15 bi30Tg dr B5, Tg(5sox11b-gata2a:GFP)bi30 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(B5sox11b-gata2a:GFP) ZDB-TGCONSTRCT-110127-13 2019-09-17
ZDB-ALT-110127-16 bi31Tg hs 6, Tg(6Hsa.SOX11-gata2a:GFP)bi31 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(H6Hsa.SOX11-gata2a:GFP) ZDB-TGCONSTRCT-110127-14 2019-09-17
ZDB-ALT-110127-17 bi32Tg dr A6, Tg(6sox11a-gata2a:GFPbi32 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(A6sox11a-gata2a:GFP) ZDB-TGCONSTRCT-110127-15 2019-09-17
ZDB-ALT-110127-18 bi33Tg dr B6, Tg(6sox11b-gata2a:GFP)bi33 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(B6sox11b-gata2a:GFP) ZDB-TGCONSTRCT-110127-16 2019-09-17
ZDB-ALT-110127-19 bi34Tg hs 7, Tg(7Hsa.SOX11-gata2a:GFP)bi34 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(H7Hsa.SOX11-gata2a:GFP) ZDB-TGCONSTRCT-110127-17 2019-09-17
ZDB-ALT-110127-20 bi35Tg dr A7, Tg(7sox11a-gata2a:GFP)bi35 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(A7sox11a-gata2a:GFP) ZDB-TGCONSTRCT-110127-18 2019-09-17
ZDB-ALT-110201-11 bi36Tg 1a, Tg(hoxb3a:GFP)bi36 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(hoxb3a:GFP) ZDB-TGCONSTRCT-110201-11 2019-09-17
ZDB-ALT-110201-12 bi37Tg 2a, Tg(hoxb3a:GFP)bi37 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(hoxb3a:GFP) ZDB-TGCONSTRCT-110201-11 2019-09-17
ZDB-ALT-110201-13 bi38Tg 8a, Tg(hoxb3a:GFP)bi38 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(hoxb3a:GFP) ZDB-TGCONSTRCT-110201-11 2019-09-17
ZDB-ALT-110201-14 bi39Tg 9a, Tg(hoxb3a:GFP)bi39 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(hoxb3a:GFP) ZDB-TGCONSTRCT-110201-11 2019-09-17
ZDB-ALT-110131-3 bi3Tg Tg(fgf8a.3:GFP)bi3 Transgenic Insertion embryos treated with DNA Becker Lab ZDB-LAB-990719-1 Unmapped Tg3(fgf8a:GFP) ZDB-TGCONSTRCT-110131-3 2019-09-17
ZDB-ALT-110201-15 bi40Tg Tg(-5.7hoxa4a:GFP)bi40 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-5.7hoxa4a:GFP) ZDB-TGCONSTRCT-110201-12 2019-09-17
ZDB-ALT-110201-16 bi41Tg Tg(-4.3hoxa4a:GFP)bi41 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-4.3hoxa4a:GFP) ZDB-TGCONSTRCT-110201-13 2019-09-17
ZDB-ALT-110201-17 bi42Tg Tg(-3.7hoxa4a:GFP)bi42 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-3.7hoxa4a:GFP) ZDB-TGCONSTRCT-110201-15 2019-09-17
ZDB-ALT-110201-18 bi43Tg Tg(-1.7hoxa4a:GFP)bi43 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-1.7hoxa4a:GFP) ZDB-TGCONSTRCT-110201-16 2019-09-17
ZDB-ALT-110201-19 bi44Tg Tg(hoxa4a:GFP)bi44 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(hoxa4a:GFP) ZDB-TGCONSTRCT-110201-17 2019-09-17
ZDB-ALT-110201-20 bi45Tg Tg(-11.3hoxb4a:GFP)bi45 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-11.3hoxb4a:GFP) ZDB-TGCONSTRCT-110201-18 2019-09-17
ZDB-ALT-110201-21 bi46Tg Tg(-8.7hoxb4a:GFP)bi46 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-8.7hoxb4a:GFP) ZDB-TGCONSTRCT-110201-19 2019-09-17
ZDB-ALT-110201-22 bi47Tg Tg(-7.7hoxb4a:GFP)bi47 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-7.7hoxb4a:GFP) ZDB-TGCONSTRCT-110201-20 2019-09-17
ZDB-ALT-110201-23 bi48Tg Tg(-7.3hoxb4a:GFP)bi48 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-7.3hoxb4a:GFP) ZDB-TGCONSTRCT-110201-21 2019-09-17
ZDB-ALT-110201-24 bi49Tg Tg(-4.5hoxb4a:GFP)bi49 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-4.5hoxb4a:GFP) ZDB-TGCONSTRCT-110201-22 2019-09-17
ZDB-ALT-110131-4 bi4Tg Tg(fgf8a.4:GFP)bi4 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg4(fgf8a:GFP) ZDB-TGCONSTRCT-110131-4 2019-09-17
ZDB-ALT-110201-25 bi50Tg Tg(-1.2hoxb4a:GFP)bi50 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-1.2hoxb4a:GFP) ZDB-TGCONSTRCT-110201-23 2019-09-17
ZDB-ALT-110201-26 bi51Tg Tg(hoxb4a:GFP)bi51 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(hoxb4a:GFP) ZDB-TGCONSTRCT-110201-24 2019-09-17
ZDB-ALT-110201-27 bi52Tg Tg(1.9hoxb4a:GFP)bi52 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(1.9hoxb4a:GFP) ZDB-TGCONSTRCT-110201-25 2019-09-17
ZDB-ALT-110201-28 bi53Tg Tg(3.2hoxb4a:GFP)bi53 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(3.2hoxb4a:GFP) ZDB-TGCONSTRCT-110201-26 2019-09-17
ZDB-ALT-110201-29 bi54Tg Tg(-8.7hoxc4a:GFP)bi54 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-8.7hoxc4a:GFP) ZDB-TGCONSTRCT-110201-27 2019-09-17
ZDB-ALT-110201-30 bi55Tg Tg(-2.6hoxc4a:GFP)bi55 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-2.6hoxc4a:GFP) ZDB-TGCONSTRCT-110201-28 2019-09-17
ZDB-ALT-110201-31 bi56Tg Tg(hoxc4a:GFP)bi56 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(hoxc4a:GFP) ZDB-TGCONSTRCT-110201-29 2019-09-17
ZDB-ALT-110201-32 bi57Tg Tg(3.5hoxc4a:GFP)bi57 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(3.5hoxc4a:GFP) ZDB-TGCONSTRCT-110201-30 2019-09-17
ZDB-ALT-110201-33 bi58Tg Tg(-12.2hoxd4a:GFP)bi58 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-12.2hoxd4a:GFP) ZDB-TGCONSTRCT-110201-31 2019-09-17
ZDB-ALT-110202-1 bi59Tg Tg(-10.1hoxd4a:GFP)bi59 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-10.1hoxd4a:GFP) ZDB-TGCONSTRCT-110202-1 2019-09-17
ZDB-ALT-110131-5 bi5Tg Tg(fgf8a.5:GFP)bi5 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg5(fgf8a:GFP) ZDB-TGCONSTRCT-110131-5 2019-09-17
ZDB-ALT-110202-2 bi60Tg Tg(-8.3hoxd4a:GFP)bi60 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-8.3hoxd4a:GFP) ZDB-TGCONSTRCT-110202-2 2019-09-17
ZDB-ALT-110202-3 bi61Tg Tg(-4.5hoxd4a:GFP)bi61 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-4.5hoxd4a:GFP) ZDB-TGCONSTRCT-110202-3 2019-09-17
ZDB-ALT-110202-4 bi62Tg Tg(-2.8hoxd4a:GFP)bi62 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-2.8hoxd4a:GFP) ZDB-TGCONSTRCT-110202-4 2019-09-17
ZDB-ALT-110202-5 bi63Tg Tg(-2.3hoxd4a:GFP)bi63 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-2.3hoxd4a:GFP) ZDB-TGCONSTRCT-110202-5 2019-09-17
ZDB-ALT-110202-6 bi64Tg Tg(-1.7hoxd4a:GFP)bi64 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(-1.7hoxd4a:GFP) ZDB-TGCONSTRCT-110202-7 2019-09-17
ZDB-ALT-110202-7 bi65Tg Tg(hoxd4a:GFP)bi65 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(hoxd4a:GFP) ZDB-TGCONSTRCT-110202-8 2019-09-17
ZDB-ALT-110202-8 bi66Tg Tg(1.1hoxd4a:GFP)bi66 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(1.1hoxd4a:GFP) ZDB-TGCONSTRCT-110202-9 2019-09-17
ZDB-ALT-110202-9 bi67Tg Tg(5.6hoxd4a:GFP)bi67 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(5.6hoxd4a:GFP) ZDB-TGCONSTRCT-110202-10 2019-09-17
ZDB-ALT-110202-10 bi68Tg Tg(6.3hoxd4a:GFP)bi68 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(6.3hoxd4a:GFP) ZDB-TGCONSTRCT-110202-11 2019-09-17
ZDB-ALT-110202-11 bi69Tg Tg(7.7hoxd4a:GFP)bi69 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(7.7hoxd4a:GFP) ZDB-TGCONSTRCT-110202-12 2019-09-17
ZDB-ALT-110131-6 bi6Tg Tg(fgf8a.6:GFP)bi6 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg6(fgf8a:GFP) ZDB-TGCONSTRCT-110131-6 2019-09-17
ZDB-ALT-110202-12 bi70Tg Tg(Bfl.Hox4.1:GFP)bi70 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(Bfl.Hox4:GFP) ZDB-TGCONSTRCT-110202-13 2019-09-17
ZDB-ALT-110202-13 bi71Tg Tg(Bfl.Hox4.2:GFP)bi71 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Bfl.Hox4:GFP) ZDB-TGCONSTRCT-110202-15 2019-09-17
ZDB-ALT-110202-14 bi72Tg Tg(Bfl.Hox4.3:GFP)bi72 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg3(Bfl.Hox4:GFP) ZDB-TGCONSTRCT-110202-16 2019-09-17
ZDB-ALT-110202-15 bi73Tg Tg(Hsa.PAX6-gata2a:GFP)bi73 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Hsa.PAX6-gata2a:GFP) ZDB-TGCONSTRCT-110202-17 2019-09-17
ZDB-ALT-110722-5 bi77Tg Tg(1Hsa.SOX3-gata2a:EGFP)bi77 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(Hsa.SOX3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-2 2019-09-17
ZDB-ALT-110722-6 bi78Tg Tg(1sox3-gata2a:EGFP)bi78 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(sox3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-3 2019-09-17
ZDB-ALT-110722-7 bi79Tg Tg(2Hsa.SOX3-gata2a:EGFP)bi79 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Hsa.SOX3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-4 2019-09-17
ZDB-ALT-110131-7 bi7Tg Tg(fgf8a.7:GFP)bi7 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg7(fgf8a:GFP) ZDB-TGCONSTRCT-110131-7 2019-09-17
ZDB-ALT-110722-8 bi80Tg Tg(2sox3-gata2a:EGFP)bi80 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(sox3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-5 2019-09-17
ZDB-ALT-110722-9 bi81Tg Tg(3Hsa.SOX3-gata2a:EGFP)bi81 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg3(Hsa.SOX3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-6 2019-09-17
ZDB-ALT-110722-10 bi82Tg Tg(3sox3-gata2a:EGFP)bi82 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg3(sox3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-7 2019-09-17
ZDB-ALT-110722-11 bi83Tg Tg(4Hsa.SOX3-gata2a:EGFP)bi83 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg4(Hsa.SOX3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-8 2019-09-17
ZDB-ALT-110722-12 bi84Tg Tg(4sox3-gata2a:EGFP)bi84 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg4(sox3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-9 2019-09-17
ZDB-ALT-110722-13 bi85Tg Tg(5Hsa.SOX3-gata2a:EGFP)bi85 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg5(Hsa.SOX3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-10 2019-09-17
ZDB-ALT-110722-14 bi86Tg Tg(5sox3-gata2a:EGFP)bi86 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg5(sox3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-11 2019-09-17
ZDB-ALT-110722-15 bi87Tg Tg(6Hsa.SOX3-gata2a:EGFP)bi87 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg6(Hsa.SOX3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-12 2019-09-17
ZDB-ALT-110722-16 bi88Tg Tg(6sox3-gata2a:EGFP)bi88 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg6(sox3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-13 2019-09-17
ZDB-ALT-110722-17 bi89Tg Tg(7Hsa.SOX3-gata2a:EGFP)bi89 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg7(Hsa.SOX3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-14 2019-09-17
ZDB-ALT-110131-8 bi8Tg Tg(fgf8a.8:GFP)bi8 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg8(fgf8a:GFP) ZDB-TGCONSTRCT-110131-8 2019-09-17
ZDB-ALT-110722-18 bi90Tg Tg(7sox3-gata2a:EGFP)bi90 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg7(sox3-gata2a:EGFP) ZDB-TGCONSTRCT-110722-15 2019-09-17
ZDB-ALT-110722-19 bi91Tg Tg(8Hsa.SOX3-Hsa.ATP11C:EGFP)bi91 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Hsa.SOX3-Hsa.ATP11C:EGFP) ZDB-TGCONSTRCT-110722-16 2019-09-17
ZDB-ALT-110722-20 bi92Tg Tg(8Hsa.SOX3-atp11c:EGFP)bi92 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg(Hsa.SOX3-atp11c:EGFP) ZDB-TGCONSTRCT-110722-17 2019-09-17
ZDB-ALT-110722-21 bi93Tg Tg(1pax6a-gata2a:EGFP)bi93 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(pax6a-gata2a:EGFP) ZDB-TGCONSTRCT-110722-18 2019-09-17
ZDB-ALT-110722-22 bi94Tg Tg(1Hsa.PAX6-gata2a:EGFP)bi94 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg1(Hsa.PAX6-gata2a:EGFP) ZDB-TGCONSTRCT-110722-19 2019-09-17
ZDB-ALT-110722-23 bi95Tg Tg(2pax6a-gata2a:EGFP)bi95 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(pax6a-gata2a:EGFP) ZDB-TGCONSTRCT-110722-20 2019-09-17
ZDB-ALT-110722-24 bi96Tg Tg(2Hsa.PAX6-gata2a:EGFP)bi96 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg2(Hsa.PAX6-gata2a:EGFP) ZDB-TGCONSTRCT-110722-21 2019-09-17
ZDB-ALT-110722-25 bi97Tg Tg(3Hsa.PAX6-gata2a:EGFP)bi97 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg3(Hsa.PAX6-gata2a:EGFP) ZDB-TGCONSTRCT-110722-22 2019-09-17
ZDB-ALT-110722-26 bi98Tg Tg(3pax6a-gata2a:EGFP)bi98 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg3(pax6a-gata2a:EGFP) ZDB-TGCONSTRCT-110722-23 2019-09-17
ZDB-ALT-110722-27 bi99Tg Tg(4Hsa.PAX6-gata2a:EGFP)bi99 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg4(Hsa.PAX6-gata2a:EGFP) ZDB-TGCONSTRCT-110722-24 2019-09-17
ZDB-ALT-110131-9 bi9Tg Tg(fgf8a.9:GFP)bi9 Transgenic Insertion embryos treated with DNA This line was not maintained. Only the construct is available. Becker Lab ZDB-LAB-990719-1 Unmapped Tg9(fgf8a:GFP) ZDB-TGCONSTRCT-110131-9 2019-09-17
ZDB-ALT-121009-1 biu01Tg Tg(hcrt:Eco.NfsB-EGFP)biu01 Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(hcrt:NTR-EGFP) ZDB-TGCONSTRCT-121009-1 2019-09-17
ZDB-ALT-170109-3 biu10Tg Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(fli1a:slc16a2-EGFP) ZDB-TGCONSTRCT-170109-3 2019-09-17
ZDB-ALT-180417-2 biu11Tg Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(UAS:gphnb-EGFP) ZDB-TGCONSTRCT-180417-2 2019-09-17
ZDB-ALT-180417-3 biu12Tg Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(hcrt:gphnb-EGFP) ZDB-TGCONSTRCT-180417-3 2019-09-17
ZDB-ALT-190730-1 biu13Tg Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(UAS:NLS-EGFP-terfa) ZDB-TGCONSTRCT-190730-2 2019-09-17
ZDB-ALT-190730-2 biu14Tg Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(UAS:RCaMP1b) ZDB-TGCONSTRCT-190730-3 2019-09-17
ZDB-ALT-130325-1 biu1Tg Tg(UAS.2:EGFP)biu1 Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg3(UAS:EGFP) ZDB-TGCONSTRCT-130325-1 2019-09-17
ZDB-ALT-130410-1 biu2Tg Tg(mct8:EGFP), Tg(slc16a2:EGFP)biu2 Transgenic Insertion DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(slc16a2:EGFP) ZDB-TGCONSTRCT-130409-4 2019-09-17
ZDB-ALT-130410-2 biu3Tg Tg(mct8:GAL4), Tg(slc16a2:Gal4-VP16)biu3 Transgenic Insertion DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(slc16a2:GAL4-VP16) ZDB-TGCONSTRCT-130409-8 2019-09-17
ZDB-ALT-150122-1 biu4 Small Deletion embryos treated with zinc finger nuclease Zada et al (2014) : 7 bp deletion mutation in exon 1 of mct8, resulting in a frame shift and the incorporation of premature termination codon at amino acid 97, which led to a truncated protein. Appelbaum Lab ZDB-LAB-111129-1 Chr: 14 2019-09-17
ZDB-ALT-150115-1 biu5Tg Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(UAS:sypb-EGFP) ZDB-TGCONSTRCT-150112-1 2019-09-17
ZDB-ALT-150610-4 biu6 Insertion embryos treated with TALEN1-nptx2a biu6 is a nonsense mutation in exon 1 of nptx2a (insertion of thymidine at position 221), which resulted in a premature stop codon at position 336 and a truncated protein. Homozygous fish are viable and fertile. Appelbaum Lab ZDB-LAB-111129-1 Chr: 3 2019-09-17
ZDB-ALT-150601-3 biu7Tg Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg(hcrt:GAL4) ZDB-TGCONSTRCT-150601-3 2019-09-17
ZDB-ALT-160421-2 biu8 Small Deletion embryos treated with CRISPR1-kcnh4a biu8 has a 14 bp deletion in exon 5 of kcnh4a, which encodes part of the pore domain. The deletion introduced a premature stop codon and is predicted to result in truncated protein. Appelbaum Lab ZDB-LAB-111129-1 Chr: 3 2019-09-17
ZDB-ALT-170109-2 biu9Tg Transgenic Insertion embryos treated with DNA Appelbaum Lab ZDB-LAB-111129-1 Unmapped Tg2(UAS:TagRFP) ZDB-TGCONSTRCT-170109-2 2019-09-17
ZDB-ALT-110502-2 bk100Tg Tg(UAS-Xla.Eef1a:Rno.Grik2-Ssp.Slr1257-GFP)bk100 Transgenic Insertion embryos treated with DNA Isacoff Lab ZDB-LAB-110302-1 Unmapped Tg(UAS-Xla.Eef1a1:Rno.Grik2-Spc.Slr1257-GFP) ZDB-TGCONSTRCT-110217-5 2019-09-17
ZDB-ALT-130805-1 bk102Tg Tg(10xUAS:Rno.Grm2_L300C,cryaa:Cerulean)bk102 Transgenic Insertion embryos treated with DNA Isacoff Lab ZDB-LAB-110302-1 Unmapped Tg(10xUAS:Rno.Grm2_L300C,cryaa:Cerulean) ZDB-TGCONSTRCT-130805-1 2019-09-17
ZDB-ALT-100609-1 bk14Tg Tg(-1.2dld:dld-mcherry)bk14, Tg(-1.2dld:dld-mcherry)zf191, zf191 Transgenic Insertion embryos treated with DNA Amacher Lab ZDB-LAB-001018-2 Unmapped Tg(-1.2dld:dld-mCherry) ZDB-TGCONSTRCT-100609-1 2019-09-17
ZDB-ALT-130104-3 bk15Tg Tg(her1:her1-Venus)bk15 Transgenic Insertion embryos treated with DNA Amacher Lab ZDB-LAB-001018-2 Unmapped Tg(her1:her1-Venus) ZDB-TGCONSTRCT-130104-1 2019-09-17
ZDB-ALT-140808-3 bk201Tg Transgenic Insertion embryos treated with DNA Ngai Lab ZDB-LAB-000515-1 Unmapped Tg(ompb:GAL4) ZDB-TGCONSTRCT-140808-3 2019-09-17
ZDB-ALT-140924-2 bk301Tg Transgenic Insertion embryos treated with DNA Richard H. Kramer Lab ZDB-LAB-140919-1 Unmapped Tg(-3.2gnat2:cacna2d4a-pHGFP,myl7:EGFP) ZDB-TGCONSTRCT-190812-6 2019-09-17
ZDB-ALT-140924-3 bk302Tg Transgenic Insertion embryos treated with DNA Richard H. Kramer Lab ZDB-LAB-140919-1 Unmapped Tg(cx55.5:Cas.Fanac-2A-mCherry,myl7:EGFP) ZDB-TGCONSTRCT-190812-7 2019-09-17
ZDB-ALT-181031-2 bk303Tg Transgenic Insertion embryos treated with DNA Richard H. Kramer Lab ZDB-LAB-140919-1 Unmapped Tg(cx55.5:Rno.Ampa-pHGFP,myl7:EGFP) ZDB-TGCONSTRCT-190812-8 2019-09-17
ZDB-ALT-181031-3 bk304Tg Transgenic Insertion embryos treated with DNA Richard H. Kramer Lab ZDB-LAB-140919-1 Unmapped Tg(cx55.5:Hsa.CHRNA7_L141F_Y115F-Hsa.GLRA1,myl7:EGFP) ZDB-TGCONSTRCT-190813-3 2019-09-17
ZDB-ALT-151028-7 bk401Tg Transgenic Insertion embryos treated with DNA Craig Miller Lab ZDB-LAB-150817-1 Unmapped Tg(Gac.Bmp6-hsp70l:EGFP) ZDB-TGCONSTRCT-151028-15 2019-09-17
ZDB-ALT-151028-8 bk402Tg Transgenic Insertion embryos treated with DNA Craig Miller Lab ZDB-LAB-150817-1 Unmapped Tg2(Gac.Bmp6-hsp70l:EGFP) ZDB-TGCONSTRCT-151028-16 2019-09-17
ZDB-ALT-151028-9 bk403Tg Transgenic Insertion embryos treated with DNA Craig Miller Lab ZDB-LAB-150817-1 Unmapped Tg3(Gac.Bmp6-hsp70l:EGFP) ZDB-TGCONSTRCT-151028-17 2019-09-17
ZDB-ALT-151028-10 bk404Tg Transgenic Insertion embryos treated with DNA Craig Miller Lab ZDB-LAB-150817-1 Unmapped Tg4(Gac.Bmp6-hsp70l:EGFP) ZDB-TGCONSTRCT-151028-18 2019-09-17
ZDB-ALT-151028-11 bk405Tg Transgenic Insertion embryos treated with DNA Craig Miller Lab ZDB-LAB-150817-1 Unmapped Tg(bmp6-hsp70l:EGFP) ZDB-TGCONSTRCT-151028-13 2019-09-17
ZDB-ALT-151028-12 bk406Tg Transgenic Insertion embryos treated with DNA Craig Miller Lab ZDB-LAB-150817-1 Unmapped Tg(Gmo.Bmp6-hsp70l:EGFP) ZDB-TGCONSTRCT-151029-5 2019-09-17
ZDB-ALT-151028-13 bk407Tg Transgenic Insertion embryos treated with DNA Craig Miller Lab ZDB-LAB-150817-1 Unmapped Tg(Ola.Bmp6-hsp70l:EGFP) ZDB-TGCONSTRCT-151028-14 2019-09-17
ZDB-ALT-050209-68 bmp2b_unspecified un_bmp2b, unspecified_bmp2b, un_swr Unspecified Chr: 20 2019-09-17
ZDB-ALT-160511-1 bns1 bn1 Small Deletion embryos treated with TALEN1-vegfaa 10 bp deletion, resulting in frame shift beginning after glutamine Q60 and a premature stop codon following serine S113. Likely represents a null allele.; p.Glu61Metfs*54 Stainier Lab ZDB-LAB-970417-60 Chr: 16 2019-09-17
ZDB-ALT-161122-13 bns100Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(hsp70l:dnvegfaa) ZDB-TGCONSTRCT-161122-1 2019-09-17
ZDB-ALT-170921-15 bns101 Small Deletion embryos treated with TALEN1-nrg1 the predicted truncated Nrg1 protein in mutant animals lacks the Ig-like, EGF-like and TM domains. Stainier Lab ZDB-LAB-970417-60 Chr: 10 2019-09-17
ZDB-ALT-180612-4 bns102 Small Deletion embryos treated with CRISPR1-ins Stainier Lab ZDB-LAB-970417-60 Chr: 5 2019-09-17
ZDB-ALT-170131-1 bns103Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:EGFP-podxl) ZDB-TGCONSTRCT-170131-1 2019-09-17
ZDB-ALT-171002-16 bns106Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped TgFOS(asb2b:GFP-asb2b) ZDB-TGCONSTRCT-171002-7 2019-09-17
ZDB-ALT-171002-15 bns107Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped TgFOS(asb2b:GFP-GAL4FF) ZDB-TGCONSTRCT-171002-6 2019-09-17
ZDB-ALT-160811-2 bns11 Small Deletion embryos treated with TALEN3-klf2a Stainier Lab ZDB-LAB-970417-60 Chr: 22 2019-09-17
ZDB-ALT-170907-2 bns110 Small Deletion embryos treated with CRISPR1-cavin1b The cavin1b bns110 allele contains a 7-nt deletion that creates an early stop codon at aa 155, i.e., before the end of the second coiled-coil domain. This mutation truncates the predicted protein from both cavin1b transcripts and causes decay of the long transcript, but does not eliminate the short transcript. Stainier Lab ZDB-LAB-970417-60 Chr: 24 2019-09-17
ZDB-ALT-160811-3 bns12 Small Deletion embryos treated with TALEN1-klf2b Stainier Lab ZDB-LAB-970417-60 Chr: 2 2019-09-17
ZDB-ALT-180920-2 bns135 Small Deletion embryos treated with TALEN1-notch1a Stainier Lab ZDB-LAB-970417-60 Chr: 21 2019-09-17
ZDB-ALT-181008-6 bns136Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(fli1a:Tomato-2A-hhex) ZDB-TGCONSTRCT-181008-2 2019-09-17
ZDB-ALT-170921-16 bns140Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:nrg2a-2A-Tomato) ZDB-TGCONSTRCT-170921-9 2019-09-17
ZDB-ALT-171002-12 bns141Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:LIFEACT-Tomato) ZDB-TGCONSTRCT-171002-3 2019-09-17
ZDB-ALT-171002-13 bns142Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:EGFP-tcf3b-2A-Tomato) ZDB-TGCONSTRCT-171002-4 2019-09-17
ZDB-ALT-171002-14 bns143Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:id2b-2A-Tomato) ZDB-TGCONSTRCT-171002-5 2019-09-17
ZDB-ALT-171002-17 bns144 Insertion embryos treated with CRISPR1-asb2a.1 Stainier Lab ZDB-LAB-970417-60 Chr: 20 2019-09-17
ZDB-ALT-180504-5 bns145Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:mstnb-2A-Hsa.HISTH2BJ-EGFP) ZDB-TGCONSTRCT-180504-4 2019-09-17
ZDB-ALT-180504-4 bns146Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:inhbaa-2A-Hsa.HISTH2BJ-EGFP) ZDB-TGCONSTRCT-180504-3 2019-09-17
ZDB-ALT-180330-1 bns15Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped TgBAC(meis2b:GAL4FF) ZDB-TGCONSTRCT-180330-1 2019-09-17
ZDB-ALT-160602-13 bns18 Small Deletion embryos treated with TALEN1-id4 truncation in the bHLH domain of Id4 Stainier Lab ZDB-LAB-970417-60 Chr: 16 2019-09-17
ZDB-ALT-190813-4 bns189 hbegfaΔ7 Small Deletion embryos treated with CRISPR1-hbegfa Stainier Lab ZDB-LAB-970417-60 Chr: 14 2019-09-17
ZDB-ALT-180608-2 bns19 Small Deletion embryos treated with CRISPR3-yap1 p.Ile39Argfs*72 Stainier Lab ZDB-LAB-970417-60 Chr: 18 2019-09-17
ZDB-ALT-180327-8 bns193Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:BFP-CAAX) ZDB-TGCONSTRCT-180327-1 2019-09-17
ZDB-ALT-190604-4 bns197Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(-0.2myl7:tdTomato-podxl) ZDB-TGCONSTRCT-190604-4 2019-09-17
ZDB-ALT-170921-17 bns199Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(fli1a:nrg2a-2A-Tomato) ZDB-TGCONSTRCT-171113-2 2019-09-17
ZDB-ALT-180824-1 bns2 Small Deletion embryos treated with TALEN6-mir126a Stainier Lab ZDB-LAB-970417-60 Chr: 8 2019-09-17
ZDB-ALT-190604-2 bns200Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:klf2a-2A-tdTomato) ZDB-TGCONSTRCT-190604-2 2019-09-17
ZDB-ALT-190814-5 bns201 alcamaΔ10 Small Deletion embryos treated with TALEN Stainier Lab ZDB-LAB-970417-60 Chr: 10 2019-09-17
ZDB-ALT-190813-5 bns203 hbegfaΔ3 Small Deletion embryos treated with CRISPR1-hbegfa Stainier Lab ZDB-LAB-970417-60 Chr: 14 2019-09-17
ZDB-ALT-190712-2 bns206Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(UAS:dnvcla-GFP) ZDB-TGCONSTRCT-190712-1 2019-09-17
ZDB-ALT-180920-1 bns231 Small Deletion embryos treated with CRISPR1-epas1a Stainier Lab ZDB-LAB-970417-60 Chr: 12 2019-09-17
ZDB-ALT-180921-1 bns232 Indel embryos treated with TALEN3-epas1b Stainier Lab ZDB-LAB-970417-60 Chr: 13 2019-09-17
ZDB-ALT-190604-3 bns234Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:klf2b-2A-tdTomato) ZDB-TGCONSTRCT-190604-3 2019-09-17
ZDB-ALT-190604-1 bns235Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(fli1a:klf2b-2A-tdTomato) ZDB-TGCONSTRCT-190604-1 2019-09-17
ZDB-ALT-180608-4 bns240Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:mark3a-TagRFP) ZDB-TGCONSTRCT-180608-2 2019-09-17
ZDB-ALT-190813-6 bns241 vclaΔ13 Small Deletion embryos treated with CRISPR1-vcla Stainier Lab ZDB-LAB-970417-60 Chr: 13 2019-09-17
ZDB-ALT-190814-3 bns242 Promoter-less Small Deletion embryos treated with CRISPR2-vegfaa, CRISPR3-vegfaa Stainier Lab ZDB-LAB-970417-60 Unmapped 2019-09-17
ZDB-ALT-190813-7 bns243 Small Deletion embryos treated with CRISPR2-hbegfa, CRISPR3-hbegfa Full locus deletion. Stainier Lab ZDB-LAB-970417-60 Unmapped 2019-09-17
ZDB-ALT-190814-6 bns244 promoter-less Small Deletion embryos treated with CRISPR1-alcama, CRISPR2-alcama Stainier Lab ZDB-LAB-970417-60 Unmapped 2019-09-17
ZDB-ALT-190822-8 bns247 Small Deletion embryos treated with CRISPR3-vclb Stainier Lab ZDB-LAB-970417-60 Chr: 12 2019-09-17
ZDB-ALT-190822-7 bns275 Small Deletion embryos treated with CRISPR1-apbb1ip Stainier Lab ZDB-LAB-970417-60 Chr: 24 2019-09-17
ZDB-ALT-170126-5 bns29 Indel embryos treated with CRISPR1-flt1, CRISPR2-flt1 c.258delinsGGC Stainier Lab ZDB-LAB-970417-60 Chr: 24 2019-09-17
ZDB-ALT-190403-10 bns292 Small Deletion embryos treated with TALEN1-chchd4a p. Gln67Gly*9 Stainier Lab ZDB-LAB-970417-60 Chr: 11 2019-09-17
ZDB-ALT-190403-11 bns293 Small Deletion embryos treated with TALEN1-chchd4b p.Glu48Gly*32 Stainier Lab ZDB-LAB-970417-60 Chr: 6 2019-09-17
ZDB-ALT-180824-2 bns3 Small Deletion embryos treated with TALEN4-mir126b Stainier Lab ZDB-LAB-970417-60 Ambiguous 2019-09-17
ZDB-ALT-190813-8 bns300 exon22 ins1 Insertion embryos treated with CRISPR1-vcla Stainier Lab ZDB-LAB-970417-60 Chr: 13 2019-09-17
ZDB-ALT-190813-9 bns301 vegfaa5′UTRΔ10 Small Deletion embryos treated with CRISPR1-vegfaa Stainier Lab ZDB-LAB-970417-60 Chr: 16 2019-09-17
ZDB-ALT-190814-2 bns302 full locus del. Small Deletion embryos treated with CRISPR5-egfl7, CRISPR6-egfl7 Stainier Lab ZDB-LAB-970417-60 Unmapped 2019-09-17
ZDB-ALT-190814-1 bns303 egfl75′UTRΔ3 Small Deletion embryos treated with CRISPR4-egfl7 Stainier Lab ZDB-LAB-970417-60 Chr: 21 2019-09-17
ZDB-ALT-061101-112 bns31131 t31131 Point Mutation ENU Sequence analysis shows that the t31131 mutant allele contains a nonsense mutation (123 T>A) in ubiad1 introducing a premature stop codon at amino acid position 41, likely generating a null allele. Stainier Lab ZDB-LAB-970417-60 Chr: 8 2019-09-17
ZDB-ALT-171002-18 bns33 Small Deletion embryos treated with CRISPR1-asb2b Stainier Lab ZDB-LAB-970417-60 Chr: 17 2019-09-17
ZDB-ALT-180608-1 bns35 Insertion embryos treated with CRISPR1-wwtr1 The bns35 allele has a 29 bp insertion in exon 2 of the wwtr1 gene. This out-of-frame insertion is predicted to cause the production of a truncated protein (p.Pro145Glnfs*15). Stainier Lab ZDB-LAB-970417-60 Chr: 22 2019-09-17
ZDB-ALT-180503-5 bns37 Small Deletion embryos treated with TALEN-inhbaa Stainier Lab ZDB-LAB-970417-60 Chr: 24 2019-09-17
ZDB-ALT-180503-6 bns5 Small Deletion embryos treated with TALEN2-mstnb Stainier Lab ZDB-LAB-970417-60 Chr: 9 2019-09-17
ZDB-ALT-170119-2 bns50 Small Deletion embryos treated with TALEN1-ccn2a Stainier Lab ZDB-LAB-970417-60 Chr: 20 2019-09-17
ZDB-ALT-160728-2 bns59 Small Deletion embryos treated with CRISPR1-npas4l Protein truncates at position 564 after 19 missense amino acids. Stainier Lab ZDB-LAB-970417-60 Chr: 13 2019-09-17
ZDB-ALT-160921-7 bns78Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:cdh2-Tomato) ZDB-TGCONSTRCT-160921-6 2019-09-17
ZDB-ALT-181102-5 bns7Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(myl7:mCherry-CAAX) ZDB-TGCONSTRCT-181102-8 2019-09-17
ZDB-ALT-170119-8 bns80Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(hsp70l:flt1,cryaa:Cerulean) ZDB-TGCONSTRCT-170119-2 2019-09-17
ZDB-ALT-170119-9 bns82Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(hsp70l:flt4,cryaa:Cerulean) ZDB-TGCONSTRCT-170119-3 2019-09-17
ZDB-ALT-171002-10 bns89 Indel embryos treated with CRISPR1-hif1aa The allele contains an indel mutation (−4) and 3 SNVs (single nucleotide variants) in the second PAS domain, leading to a premature stop codon after a 13 amino acid-long missense segment. Stainier Lab ZDB-LAB-970417-60 Chr: 13 2019-09-17
ZDB-ALT-171002-11 bns90 Small Deletion embryos treated with TALEN3-hif1ab Allele contains an indel mutation (−8) in the first PAS domain (exon6) leading to a premature stop codon after a 23 amino acid-long missense segment. Stainier Lab ZDB-LAB-970417-60 Chr: 20 2019-09-17
ZDB-ALT-180605-5 bns91Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(6xTETRE-Ocu.Hbb2:EGFP) ZDB-TGCONSTRCT-180605-5 2019-09-17
ZDB-ALT-170209-3 bns92 Insertion embryos treated with CRISPR p.Met88Trpfs*18 Stainier Lab ZDB-LAB-970417-60 Chr: 4 2019-09-17
ZDB-ALT-180419-3 bns97Tg Tg(ubb:FATC) Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(ubb:LOX2272-Cerulean,UAS:LOXP-LOX2272-GAL4-LOXP-LIFEACT-GFP) ZDB-TGCONSTRCT-180419-2 2019-09-17
ZDB-ALT-180419-4 bns98Tg Tg(ubb:NATC) Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(ubb:LOX2272-Cerulean,UAS:LOXP-LOX2272-GAL4-LOXP-NTR-mCherry) ZDB-TGCONSTRCT-180419-1 2019-09-17
ZDB-ALT-160804-2 bns9Tg Transgenic Insertion embryos treated with DNA Stainier Lab ZDB-LAB-970417-60 Unmapped Tg(fli1a:Hsa.B4GALT1-mCherry) ZDB-TGCONSTRCT-160804-1 2019-09-17
ZDB-ALT-180305-4 bo1Tg Transgenic Insertion embryos treated with DNA Jackman Lab ZDB-LAB-100414-1 Unmapped Tg(dlx2b-actb2:EGFP,myl7:GFP) ZDB-TGCONSTRCT-180305-1 2019-09-17
ZDB-ALT-171019-2 bsl077 x3078 Small Deletion embryos treated with TALEN1-golgb1 bsl077 has an 8 bp deletion in exon 14 in the spacer sequence ... This resulted in a frameshift at position 3029, and a premature stop codon at position 3078 (E3027fsX3078- T3028_A3029del, henceforth called golgb1 x3078. Homozygotes are viable and can produce viable offspring. Hammond Lab ZDB-LAB-101214-1 Chr: 4 2019-09-17
ZDB-ALT-140429-2 bsl251Tg Transgenic Insertion embryos treated with DNA Martin Lab ZDB-LAB-101004-1 Unmapped Tg(UAS:Hsa.WAS-EGFP,myl7:mCherry) ZDB-TGCONSTRCT-140429-12 2019-09-17
ZDB-ALT-140429-3 bsl252Tg Transgenic Insertion embryos treated with DNA Martin Lab ZDB-LAB-101004-1 Unmapped Tg(UAS:Hsa.WAS_A134T-EGFP,myl7:mCherry) ZDB-TGCONSTRCT-140429-13 2019-09-17
ZDB-ALT-140429-4 bsl253Tg Transgenic Insertion embryos treated with DNA Martin Lab ZDB-LAB-101004-1 Unmapped Tg(UAS:Hsa.WAS_H246D-EGFP,myl7:mCherry) ZDB-TGCONSTRCT-140429-14 2019-09-17
ZDB-ALT-140429-5 bsl254Tg Transgenic Insertion embryos treated with DNA Martin Lab ZDB-LAB-101004-1 Unmapped Tg(UAS:Hsa.WAS_Y291F-EGFP,myl7:mCherry) ZDB-TGCONSTRCT-140429-15 2019-09-17
ZDB-ALT-140429-6 bsl255Tg Transgenic Insertion embryos treated with DNA Martin Lab ZDB-LAB-101004-1 Unmapped Tg(UAS:Hsa.WAS_I294T-EGFP,myl7:mCherry) ZDB-TGCONSTRCT-140429-16 2019-09-17
ZDB-ALT-120809-4 bu1Tg Tg(spon1b:EGFP)bu1 Transgenic Insertion embryos treated with DNA Zhdanova Lab ZDB-LAB-021127-1 Unmapped Tg(spon1b:EGFP) ZDB-TGCONSTRCT-120809-4 2019-09-17
ZDB-ALT-160329-1 bu2Tg Transgenic Insertion embryos treated with DNA Feng Lab ZDB-LAB-120827-1 Unmapped Tg(mitfa:mitfa), Tg(rag2:EGFP) ZDB-TGCONSTRCT-140429-11, ZDB-TGCONSTRCT-160329-1 2019-09-17
ZDB-ALT-160329-2 bu3Tg Transgenic Insertion embryos treated with DNA Feng Lab ZDB-LAB-120827-1 Unmapped Tg(mitfa:mitfa), Tg2(rag2:mCherry) ZDB-TGCONSTRCT-140429-11, ZDB-TGCONSTRCT-160329-2 2019-09-17
ZDB-ALT-160329-3 bu4Tg Transgenic Insertion embryos treated with DNA Feng Lab ZDB-LAB-120827-1 Unmapped Tg(mitfa:mitfa), Tg(rag2:mCherry-bcl2a) ZDB-TGCONSTRCT-140429-11, ZDB-TGCONSTRCT-160329-3 2019-09-17
ZDB-ALT-160329-4 bu5Tg Transgenic Insertion embryos treated with DNA Feng Lab ZDB-LAB-120827-1 Unmapped Tg(mitfa:mitfa), Tg(rag2:EGFP-bcl2l1) ZDB-TGCONSTRCT-140429-11, ZDB-TGCONSTRCT-160329-5 2019-09-17
ZDB-ALT-160329-5 bu6Tg Transgenic Insertion embryos treated with DNA Feng Lab ZDB-LAB-120827-1 Unmapped Tg(mitfa:mitfa), Tg(rag2:mCherry-badb) ZDB-TGCONSTRCT-140429-11, ZDB-TGCONSTRCT-160329-6 2019-09-17
ZDB-ALT-160329-6 bu7Tg Transgenic Insertion embryos treated with DNA Feng Lab ZDB-LAB-120827-1 Unmapped Tg(mitfa:mitfa), Tg(rag2:mCherry-badb_L99A) ZDB-TGCONSTRCT-140429-11, ZDB-TGCONSTRCT-160329-7 2019-09-17
ZDB-ALT-101029-2 bw100Tg Tg(fog-1:EGFP), Tg(zfpm1:EGFP)bw100 Transgenic Insertion embryos treated with DNA Paw Lab ZDB-LAB-020619-1 Unmapped Tg(zfpm1:EGFP) ZDB-TGCONSTRCT-101029-1 2019-09-17
ZDB-ALT-090225-1 bw1015 Unknown adult males treated with ENU Paw Lab ZDB-LAB-020619-1 Unmapped 2019-09-17
ZDB-ALT-101029-3 bw102Tg Tg(mfrn1:EGFP), Tg(slc25a37:EGFP)bw102 Transgenic Insertion embryos treated with DNA Paw Lab ZDB-LAB-020619-1 Unmapped Tg(Mmu.Slc25a37:EGFP) ZDB-TGCONSTRCT-101029-2 2019-09-17
ZDB-ALT-170407-1 bw10Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(UAS:Hsa.APOL1) ZDB-TGCONSTRCT-170407-1 2019-09-17
ZDB-ALT-070809-4 bw115 b115 Unknown Paw Lab ZDB-LAB-020619-1 Unmapped 2019-09-17
ZDB-ALT-170407-2 bw11Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(UAS:Hsa.APOL1_S342G_I384M) ZDB-TGCONSTRCT-170407-2 2019-09-17
ZDB-ALT-070927-1 bw129 Unknown Paw Lab ZDB-LAB-020619-1 Unmapped 2019-09-17
ZDB-ALT-170407-3 bw12Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg2(UAS:Hsa.APOL1) ZDB-TGCONSTRCT-170407-3 2019-09-17
ZDB-ALT-171024-1 bw13Tg Transgenic Insertion embryos treated with DNA Bonventre Lab ZDB-LAB-170504-4 Unmapped Tg(cdh17:havcr2-RFP) ZDB-TGCONSTRCT-171024-1 2019-09-17
ZDB-ALT-170509-7 bw14Tg Transgenic Insertion embryos treated with DNA Bonventre Lab ZDB-LAB-170504-4 Unmapped Tg(cdh17:RFP) ZDB-TGCONSTRCT-170509-3 2019-09-17
ZDB-ALT-171024-2 bw15Tg Transgenic Insertion embryos treated with DNA Bonventre Lab ZDB-LAB-170504-4 Unmapped Tg(ubb:LOXP-EGFP-havcr2-LOXP-RFP) ZDB-TGCONSTRCT-171024-2 2019-09-17
ZDB-ALT-170509-8 bw16Tg Transgenic Insertion embryos treated with DNA Bonventre Lab ZDB-LAB-170504-4 Unmapped Tg(cdh17:Cre-ERT2) ZDB-TGCONSTRCT-170509-4 2019-09-17
ZDB-ALT-171012-6 bw17Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg3(kdrl:GFP) ZDB-TGCONSTRCT-171012-3 2019-09-17
ZDB-ALT-171012-7 bw18Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg2(kdrl:DsRed) ZDB-TGCONSTRCT-171012-4 2019-09-17
ZDB-ALT-171012-5 bw19Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg2(myl7:GFP) ZDB-TGCONSTRCT-171012-2 2019-09-17
ZDB-ALT-141002-1 bw1Tg zf505Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg2(hsp70l:GAL4-VP16,myl7:CFP) ZDB-TGCONSTRCT-141002-2 2019-09-17
ZDB-ALT-170621-7 bw20Tg zf717Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(ubb:GAL4) ZDB-TGCONSTRCT-170621-3 2019-09-17
ZDB-ALT-171012-4 bw21Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(UAS:Hsa.WARS2,cryaa:YFP) ZDB-TGCONSTRCT-171012-1 2019-09-17
ZDB-ALT-141002-2 bw2Tg zf506Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(UAS:nppb,Xla.Cryaa:mCherry) ZDB-TGCONSTRCT-141002-1 2019-09-17
ZDB-ALT-070927-2 bw306 Point Mutation ENU qRT-PCR and whole-mount in situ hybridization validated the loss of the cdh5 mRNA levels in mlb embryos, suggesting that the A267T stop codon resulted in nonsense-mediated decay of cdh5 mRNA. Paw Lab ZDB-LAB-020619-1 Chr: 7 2019-09-17
ZDB-ALT-080617-1 bw322 Unknown Paw Lab ZDB-LAB-020619-1 Unmapped 2019-09-17
ZDB-ALT-150410-1 bw3Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(nppa-Xla.Cryaa:YFP) ZDB-TGCONSTRCT-150410-1 2019-09-17
ZDB-ALT-110906-2 bw41c Point Mutation bw41c has a cytosine to thymine mutation introducing a premature stop codon in exon 3 of gnl2, corresponding to an arginine in position 53 within the first basic domain of the zebrafish Gnl2 protein. Paridaen et al. (2011) Paw Lab ZDB-LAB-020619-1 Chr: 16 2019-09-17
ZDB-ALT-150410-2 bw4Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(nppb-Xla.Cryaa:YFP) ZDB-TGCONSTRCT-150410-2 2019-09-17
ZDB-ALT-150410-3 bw5Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(nppa-Xla.Cryaa:Luciferase) ZDB-TGCONSTRCT-150410-3 2019-09-17
ZDB-ALT-150410-4 bw6Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(nppb-Xla.Cryaa:Luciferase) ZDB-TGCONSTRCT-150410-4 2019-09-17
ZDB-ALT-150410-5 bw7Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(UAS:Hsa.JUP,Xla.Cryaa:mCherry) ZDB-TGCONSTRCT-150410-5 2019-09-17
ZDB-ALT-150420-1 bw8Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg3(myl7:GAL4) ZDB-TGCONSTRCT-150420-1 2019-09-17
ZDB-ALT-150504-3 bw9Tg Transgenic Insertion embryos treated with DNA MacRae Lab ZDB-LAB-030925-3 Unmapped Tg(kdrl:GAL4) ZDB-TGCONSTRCT-150504-3 2019-09-17
ZDB-ALT-160603-2 bz10Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(Tni.Lnp-E1B:Kaede) ZDB-TGCONSTRCT-160607-2 2019-09-17
ZDB-ALT-160817-1 bz11Tg Transgenic Insertion embryos treated with DNA transgenic line generated by Tol2 transposon insertion in which regulatory element of carbonic anhydrase 8 drives co-expression of FyntagRFP (membrane-targeted tagRFP) and Tamoxifen-inducible Caspase8-ERT2 linked by T2A peptide exclusively in cerebellar Purkinje neurons
line allows selective ablation of cerebellar Purkinje cells by adding Tamoxifen to the rearing medium Köster Lab ZDB-LAB-060314-2 Unmapped Tg(ca8:FMA-TagRFP-2A-casp8-ERT2) ZDB-TGCONSTRCT-160817-1 2019-09-17
ZDB-ALT-181102-2 bz12Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped 2019-09-17
ZDB-ALT-181102-3 bz13Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped 2019-09-17
ZDB-ALT-181102-4 bz14Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped 2019-09-17
ZDB-ALT-190621-3 bz15Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(ca8-E1B:Hso.Arch3-TagRFPT,Hso.Arch3-TagRFPT) ZDB-TGCONSTRCT-190621-1 2019-09-17
ZDB-ALT-190917-1 bz16Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(mpeg1.1:KALTA4,he1.1:BFP2) ZDB-TGCONSTRCT-190917-1 2019-09-17
ZDB-ALT-190917-2 bz17Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(lyz:KALTA4,he1.1:BFP2) ZDB-TGCONSTRCT-190917-2 2019-09-17
ZDB-ALT-141031-1 bz1Et This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA Insertion site mapped near jam2b and displays Gal4 expression reflecting the expression of endogenous jam2b; The insertion is approximately 500 bp upstream of the jam2b protein coding region. Köster Lab ZDB-LAB-060314-2 Chr: 9 Et(shhb:KALTA4,UAS-E1B:mCherry) ZDB-ETCONSTRCT-120217-3 2019-09-17
ZDB-ALT-151204-2 bz2Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(ca8-E1B:FMATagRFP,EGFP) ZDB-TGCONSTRCT-151204-1 2019-09-17
ZDB-ALT-151204-3 bz3Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(ca8-E1B:FMATagRFP,Tae.WGA) ZDB-TGCONSTRCT-151204-3 2019-09-17
ZDB-ALT-151204-4 bz4Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(ca8-E1B:FMATagRFP) ZDB-TGCONSTRCT-151204-4 2019-09-17
ZDB-ALT-151204-5 bz5Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(ca8-E1B:Hso.Arch3-TagRFPT,GCaMP5G) ZDB-TGCONSTRCT-151204-5 2019-09-17
ZDB-ALT-151204-8 bz6Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(ca8-E1B:FMATagRFP,GCaMP) ZDB-TGCONSTRCT-151204-6 2019-09-17
ZDB-ALT-151204-6 bz7Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(ca8-E1B:Cr.ChR2-FMAVenus,RGECO) ZDB-TGCONSTRCT-151204-9 2019-09-17
ZDB-ALT-151204-7 bz8Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(5xUAS:FMAVenus-2A-3xNLS-HA-mseCFP) ZDB-TGCONSTRCT-151204-8 2019-09-17
ZDB-ALT-160603-1 bz9Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(Tni.Lnp-E1B:mRFP) ZDB-TGCONSTRCT-160607-1 2019-09-17
ZDB-ALT-030731-2 c14 Point Mutation adult males treated with ENU This is a T269A mutation. Halpern Lab ZDB-LAB-980205-5 Chr: 16 2019-09-17
ZDB-ALT-070117-1 c144 Point Mutation adult males treated with ENU The third position of codon 245 was changed from T to A, generating a stop codon within the T-box (Snelson et al. 2008, ZDB-PUB-080414-4). Halpern Lab ZDB-LAB-980205-5 Chr: 15 2019-09-17
ZDB-ALT-020308-2 c151Tg c151, Tg(cryg:GFP), Tg(cryg:GFP)c151 Transgenic Insertion DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(cryg:GFP) ZDB-TGCONSTRCT-070117-86 2019-09-17
ZDB-ALT-040412-4 c161Tg c161, Tg(flh:EGFP), Tg(flh:EGFP)c161 Transgenic Insertion DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(flh:EGFP) ZDB-TGCONSTRCT-070117-36 2019-09-17
ZDB-ALT-040412-6 c162Tg c162, Tg(flh:EGFP), Tg(flh:EGFP)c162 Transgenic Insertion DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(flh:EGFP) ZDB-TGCONSTRCT-070117-36 2019-09-17
ZDB-ALT-120126-1 c163 Point Mutation adult males treated with ENU Mutation is located at nucleotide 92 of 100 in exon 6, introducing a premature stop codon (TGT to TGA). Halpern Lab ZDB-LAB-980205-5 Chr: 6 2019-09-17
ZDB-ALT-160215-1 c186 Point Mutation adult males treated with ENU Kuan et al (2015): a single base change(G to A) in the seventh exon of zebrafish wls, leading to a premature stop codon. Halpern Lab ZDB-LAB-980205-5 Chr: 2 2019-09-17
ZDB-ALT-070314-2 c215Tg Gt(Gal4-VP16,UAS:EGFP)c215, Tg(Gal4-VP16,UAS:EGFP)c215 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-3 c218Tg Gt(Gal4-VP16,UAS:EGFP)c218, Tg(Gal4-VP16,UAS:EGFP)c218 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Chr: 6 Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-4 c220Gt This feature is representative of one or more unknown insertion sites. c220, Gt(Gal4-VP16,UAS:EGFP)c220 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Chr: 23 Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-5 c223Tg Gt(Gal4-VP16,UAS:EGFP)c223, Tg(Gal4-VP16,UAS:EGFP)c223 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Chr: 5 Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-6 c228Tg Gt(Gal4-VP16,UAS:EGFP)c228, Tg(Gal4-VP16,UAS:EGFP)c228 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-7 c229Tg Gt(Gal4-VP16,UAS:EGFP)c229, Tg(Gal4-VP16,UAS:EGFP)c229 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Chr: 9 Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-8 c230Tg Gt(Gal4-VP16,UAS:EGFP)c230, Tg(Gal4-VP16,UAS:EGFP)c230 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-9 c233Tg Gt(Gal4-VP16,UAS:EGFP)c233, Tg(Gal4-VP16,UAS:EGFP)c233 Transgenic Insertion adult males treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-10 c235Tg Gt(Gal4-VP16,UAS:EGFP)c235, Tg(Gal4-VP16,UAS:EGFP)c235 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-14 c236Tg Gt(Gal4-VP16,UAS:EGFP)c236, Gt(IRES-Gal4-VP16,UAS:EGFP)c236, Tg(Gal4-VP16,UAS:EGFP)c236 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-11 c237Tg Gt(Gal4-VP16,UAS:EGFP)c237, Tg(Gal4-VP16,UAS:EGFP)c237 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Chr: 14 Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-15 c239Tg Gt(Gal4-VP16,UAS:EGFP)c239, Gt(IRES-Gal4-VP16,UAS:EGFP)c239, Tg(Gal4-VP16,UAS:EGFP)c239 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Chr: 21 Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-12 c240Tg Gt(Gal4-VP16,UAS:EGFP)c240, Tg(Gal4-VP16,UAS:EGFP)c240 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-13 c241Tg Gt(Gal4-VP16,UAS:EGFP)c241, Tg(Gal4-VP16,UAS:EGFP)c241 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-070314-16 c247Tg Gt(Gal4-VP16,UAS:EGFP)c247, Gt(IRES-Gal4-VP16,UAS:EGFP)c247, Tg(Gal4-VP16,UAS:EGFP)c247 Transgenic Insertion embryos treated with DNA Creation of the line included injection ofTol2 transposase RNA. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-100908-1 c251Tg Gt(Gal4-VP16,UAS:EGFP)c251, Tg(Gal4-VP16,UAS:EGFP)c251 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-110805-1 c258Tg Tg(5xERE:EGFP)c258 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(5xERE:EGFP) ZDB-TGCONSTRCT-110805-3 2019-09-17
ZDB-ALT-110805-2 c259Tg Tg(5xERE:EGFP)c259 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(5xERE:EGFP) ZDB-TGCONSTRCT-110805-3 2019-09-17
ZDB-ALT-110805-3 c262Tg Tg(5xERE:EGFP)c262 Transgenic Insertion embryos treated with DNA Insertion is located in an intron of cstf1 (formerly zgc:77560). Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(5xERE:EGFP) ZDB-TGCONSTRCT-110805-3 2019-09-17
ZDB-ALT-110805-4 c263Tg Tg(5xERE:EGFP)c263 Transgenic Insertion embryos treated with DNA Insertion is located in an intergenic region 80 kb downstream of si:ch1073-188e1.1, 70 kb upstream of accn2a. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(5xERE:EGFP) ZDB-TGCONSTRCT-110805-3 2019-09-17
ZDB-ALT-070316-1 c264Tg 14xNtrCh, 14xUAS:NfsB-mCherry, Tg(UAS-E1b:NfsB-mCherry)c264, Tg(UAS:NTR-Cherry) Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(UAS-E1B:NTR-mCherry) ZDB-TGCONSTRCT-070314-2 2019-09-17
ZDB-ALT-100622-1 c269Tg Gt(Gal4-VP16,UAS:EGFP)c269, Tg(Gal4-VP16,UAS:EGFP)c269 Transgenic Insertion embryos treated with DNA Generated using Tol2. The insertion is mapped within the fourth intron of the odz4 gene. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(GAL4-VP16,UAS:EGFP) ZDB-GTCONSTRCT-070314-1 2019-09-17
ZDB-ALT-131029-4 c342Tg Tg(Xla.Eef1a1:GAL4FF-2A-mCherry,4xnrUAS:GFP)c342 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(Xla.Eef1a1:GAL4FF-2A-mCherry,4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-4 2019-09-17
ZDB-ALT-131029-6 c345Tg Tg(Xla.Eef1a1:GAL4FF-2A-mCherry,4xnrUAS:GFP)c345 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(Xla.Eef1a1:GAL4FF-2A-mCherry,4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-4 2019-09-17
ZDB-ALT-131029-5 c347Tg Tg(Xla.Eef1a1:GAL4FF-2A-mCherry,4xnrUAS:GFP)c347 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(Xla.Eef1a1:GAL4FF-2A-mCherry,4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-4 2019-09-17
ZDB-ALT-131029-7 c350Tg Tg(Xla.Eef1a1:GAL4FF-2A-mCherry,14xUAS:GFP)c350 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(Xla.Eef1a1:GAL4FF-2A-mCherry,14xUAS:GFP) ZDB-TGCONSTRCT-131029-5 2019-09-17
ZDB-ALT-131029-20 c353Tg Tg(4xnrUAS:GFP)c353 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-18 c354Tg Tg(4xnrUAS:GFP)c354 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-19 c355Tg Tg(4xnrUAS:GFP)c355 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-10 c356Tg Tg(4xnrUAS:GFP)c356 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-21 c357Tg Tg(4xnrUAS:GFP)c357 Transgenic Insertion embryos treated with DNA Insertion is located in an intron of LOC571485(tdp1), flanked by Tc1N1_DR repetitive elements. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-15 c359Tg Tg(14xUAS:GFP)c359 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(14xUAS:GFP) ZDB-TGCONSTRCT-131029-6 2019-09-17
ZDB-ALT-131029-17 c360aTg c360Tg, Tg(14xUAS:GFP)c360a Transgenic Insertion embryos treated with DNA Insertion is located in the DNA-8-9_DR repetitive element. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(14xUAS:GFP) ZDB-TGCONSTRCT-131029-6 2019-09-17
ZDB-ALT-131029-23 c360bTg Tg(14xUAS:GFP)c360b Transgenic Insertion embryos treated with DNA Insertion is located in the TE-X-5_DR repetitive element, or the Kolobok-N7_DR repetitive element. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(14xUAS:GFP) ZDB-TGCONSTRCT-131029-6 2019-09-17
ZDB-ALT-131029-8 c361Tg Tg(14xUAS:GFP)c361 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(14xUAS:GFP) ZDB-TGCONSTRCT-131029-6 2019-09-17
ZDB-ALT-131029-16 c362Tg Tg(14xUAS:GFP)c362 Transgenic Insertion embryos treated with DNA Insertion is located in the Tc1-4_DR repetitive element. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(14xUAS:GFP) ZDB-TGCONSTRCT-131029-6 2019-09-17
ZDB-ALT-131029-14 c363Tg Tg(14xUAS:GFP)c363 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(14xUAS:GFP) ZDB-TGCONSTRCT-131029-6 2019-09-17
ZDB-ALT-131029-9 c364Tg Tg(14xUAS:GFP)c364 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(14xUAS:GFP) ZDB-TGCONSTRCT-131029-6 2019-09-17
ZDB-ALT-131029-22 c367Tg Tg(4xnrUAS:GFP)c367 Transgenic Insertion embryos treated with DNA Insertion is located in an intron of nrp2b, 13 bp downstream from Polinton-1N1_DR repetitive element. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-12 c368aTg c368Tg, Tg(4xnrUAS:GFP)c368a Transgenic Insertion embryos treated with DNA Insertion is located in an intron of PLA2G4C, 165 bp upstream from DNA-TTAA-2_DR repetitive element. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-13 c368bTg Tg(4xnrUAS:GFP)c368b Transgenic Insertion embryos treated with DNA Insertion is located in a DNA2-2 DR repetitive element. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-11 c369Tg Tg(4xnrUAS:GFP)c369 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-131029-24 c370Tg Tg(4xnrUAS:GFP)c370 Transgenic Insertion embryos treated with DNA Insertion is located in a DNA-8-13_DR repetitive element. Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(4xnrUAS:GFP) ZDB-TGCONSTRCT-131029-7 2019-09-17
ZDB-ALT-130815-4 c375Tg TgBAC(gng8:Eco.NfsB-2A-CAAX-GFP)c375 Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped TgBAC(gng8:Eco.NfsB-2A-CAAX-GFP) ZDB-TGCONSTRCT-130815-4 2019-09-17
ZDB-ALT-140722-2 c399Tg Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(mnx1:QF) ZDB-TGCONSTRCT-140721-3 2019-09-17
ZDB-ALT-140722-1 c403Tg Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(5xQUAS-Cca.Actb:GFP) ZDB-TGCONSTRCT-140721-2 2019-09-17
ZDB-ALT-140423-2 c426Tg Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped TgBAC(gng8:GAL4FF) ZDB-TGCONSTRCT-140423-2 2019-09-17
ZDB-ALT-140722-3 c430Tg Transgenic Insertion embryos treated with DNA Halpern Lab ZDB-LAB-980205-5 Unmapped Tg(Xla.Eef1a1:QS,Xla.Cryg:BFP) ZDB-TGCONSTRCT-140722-1 2019-09-17
ZDB-ALT-150507-1 c574Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(hsp70l:apoa4b.1-mCherry) ZDB-TGCONSTRCT-150507-1 2019-09-17
ZDB-ALT-170501-1 c668Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(hsp70l:cav1-EGFP) ZDB-TGCONSTRCT-170501-1 2019-09-17
ZDB-ALT-170501-2 c669Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(hsp70l:cav1-EGFP) ZDB-TGCONSTRCT-170501-1 2019-09-17
ZDB-ALT-170501-3 c670Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(hsp70l:cav1-EGFP) ZDB-TGCONSTRCT-170501-1 2019-09-17
ZDB-ALT-190723-1 c809Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(fabp10a:Hsa.APOA1-mCherry) ZDB-TGCONSTRCT-190723-1 2019-09-17
ZDB-ALT-190723-2 c810Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(fabp10a:apoa1a-mCherry) ZDB-TGCONSTRCT-190723-2 2019-09-17
ZDB-ALT-190723-3 c811Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(fabp2:Hsa.APOA1-mCherry) ZDB-TGCONSTRCT-190723-3 2019-09-17
ZDB-ALT-190723-4 c812Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(fabp2:apoa1a-mCherry) ZDB-TGCONSTRCT-190723-4 2019-09-17
ZDB-ALT-190723-5 c813Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(actb2:EGFP-rab5c) ZDB-TGCONSTRCT-190723-5 2019-09-17
ZDB-ALT-190723-6 c814Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(actb2:EGFP-rab7a) ZDB-TGCONSTRCT-190723-6 2019-09-17
ZDB-ALT-190723-7 c815Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(actb2:EGFP-rab11a) ZDB-TGCONSTRCT-190723-7 2019-09-17
ZDB-ALT-190723-8 c816Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(actb2:mCherry-rab5c) ZDB-TGCONSTRCT-190723-8 2019-09-17
ZDB-ALT-190723-9 c817Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(actb2:mCherry-rab7a) ZDB-TGCONSTRCT-190723-9 2019-09-17
ZDB-ALT-190723-10 c818Tg Transgenic Insertion embryos treated with DNA Farber Lab ZDB-LAB-000330-2 Unmapped Tg(actb2:mCherry-rab11a) ZDB-TGCONSTRCT-190723-10 2019-09-17
ZDB-ALT-991201-15 c99 Insertion sperm treated with g-rays Halpern Lab ZDB-LAB-980205-5 Chr: 1 2019-09-17
ZDB-ALT-190319-1 ca101Tg Transgenic Insertion embryos treated with DNA Peng Huang Lab ZDB-LAB-131204-1 Unmapped TgBAC(nkx3-1:GAL4-VP16) ZDB-TGCONSTRCT-190319-3 2019-09-17
ZDB-ALT-190319-2 ca102Tg Transgenic Insertion embryos treated with DNA Peng Huang Lab ZDB-LAB-131204-1 Unmapped TgBAC(col1a2:GAL4-VP16) ZDB-TGCONSTRCT-190319-2 2019-09-17
ZDB-ALT-190319-3 ca103Tg Transgenic Insertion embryos treated with DNA Peng Huang Lab ZDB-LAB-131204-1 Unmapped TgBAC(col1a2:GFP) ZDB-TGCONSTRCT-190319-1 2019-09-17
ZDB-ALT-190319-4 ca104Tg Transgenic Insertion embryos treated with DNA Peng Huang Lab ZDB-LAB-131204-1 Unmapped Tg(Ola.Twist1:EGFP) ZDB-TGCONSTRCT-190319-4 2019-09-17
ZDB-ALT-171006-3 ca20 Insertion embryos treated with TALEN1-isl2a Childs Lab ZDB-LAB-010814-1 Chr: 25 2019-09-17
ZDB-ALT-181108-1 ca201 Small Deletion Kurrasch Lab ZDB-LAB-140722-2 Unmapped 2019-09-17
ZDB-ALT-171006-4 ca21 Indel embryos treated with TALEN1-isl2a Mutant has a 5 bp deletion and point mutations around the deletion site. This frameshift allele is predicted to result in a truncated protein missing the homeodomain. Childs Lab ZDB-LAB-010814-1 Chr: 25 2019-09-17
ZDB-ALT-160809-1 ca22 Point Mutation embryos treated with TALEN1-foxf2b premature stop in the conserved FOX DNA binding domain Childs Lab ZDB-LAB-010814-1 Chr: 20 2019-09-17
ZDB-ALT-160809-2 ca23 Indel embryos treated with TALEN1-foxf2b premature stop in the conserved FOX DNA binding domain Childs Lab ZDB-LAB-010814-1 Chr: 20 2019-09-17
ZDB-ALT-120726-1 ca2Tg Tg(acta2:GFP)ca2 Transgenic Insertion embryos treated with DNA Childs Lab ZDB-LAB-010814-1 Unmapped Tg(acta2:GFP) ZDB-TGCONSTRCT-120726-1 2019-09-17
ZDB-ALT-181115-7 ca301 Small Deletion McFarlane Lab ZDB-LAB-180523-1 Unmapped 2019-09-17
ZDB-ALT-190220-3 ca302 Indel McFarlane Lab ZDB-LAB-180523-1 Unmapped 2019-09-17
ZDB-ALT-190220-4 ca303 Insertion McFarlane Lab ZDB-LAB-180523-1 Unmapped 2019-09-17
ZDB-ALT-190204-1 ca304 Small Deletion McFarlane Lab ZDB-LAB-180523-1 Unmapped 2019-09-17
ZDB-ALT-190204-2 ca305 Small Deletion McFarlane Lab ZDB-LAB-180523-1 Unmapped 2019-09-17
ZDB-ALT-190204-3 ca306 Insertion McFarlane Lab ZDB-LAB-180523-1 Unmapped 2019-09-17
ZDB-ALT-190716-5 ca401 Small Deletion embryos treated with CRISPR2-nr3c1 Vijayan Lab ZDB-LAB-190531-1 Chr: 14 2019-09-17
ZDB-ALT-190716-6 ca402 Indel embryos treated with CRISPR1-nr3c2 The inserted sequence (GGAAACTGTACCC, in the nr3c2 gene) was duplicated and inserted while 5bp (CTTTG, in the nr3c2 gene) were deleted, leading to a net +8 bp insertion change. Vijayan Lab ZDB-LAB-190531-1 Chr: 1 2019-09-17
ZDB-ALT-120508-1 ca7Tg Tg(acta2:EGFP)ca7, Tg(SMA:EGFP) Transgenic Insertion embryos treated with DNA Childs Lab ZDB-LAB-010814-1 Unmapped Tg(acta2:EGFP) ZDB-TGCONSTRCT-120508-1 2019-09-17
ZDB-ALT-120508-2 ca8Tg Tg(acta2:mCherry)ca8, Tg(SMA:mCherry) Transgenic Insertion embryos treated with DNA Childs Lab ZDB-LAB-010814-1 Unmapped Tg(acta2:mCherry) ZDB-TGCONSTRCT-120508-2 2019-09-17
ZDB-ALT-131213-2 cas001Tg Tg(actb2:LOXP-DsRed-LOXP-Hsa.NRAS_G12D)cas001 Transgenic Insertion embryos treated with DNA Weijun Pan Lab ZDB-LAB-131028-1 Unmapped Tg(actb2:LOXP-DsRed-LOXP-Hsa.NRAS_G12D) ZDB-TGCONSTRCT-131213-4 2019-09-17
ZDB-ALT-151210-1 cas002 Point Mutation adult males treated with ENU This mutant has a T to G transversion at the kri1 exon 1-intron 1 consensus splicing donor site which causes a frameshift and a premature stop codon leading to the production of a truncated protein. Weijun Pan Lab ZDB-LAB-131028-1 Chr: 3 2019-09-17
ZDB-ALT-151215-2 cas003 Point Mutation ENU GAo et al (2015): C to T nonsense mutation in topbp1 gene causing an earlier stop codon before the eighth\nBRCT (BRCA1 C-terminus) domain and a putative C-terminus nuclear localization signal (NLS) of TopBP1 protein Weijun Pan Lab ZDB-LAB-131028-1 Chr: 24 2019-09-17
ZDB-ALT-190416-1 cas005 Insertion adult males treated with ENU Weijun Pan Lab ZDB-LAB-131028-1 Chr: 9 2019-09-17
ZDB-ALT-180126-1 cas009 Indel embryos treated with CRISPR1-cdkn2aip Weijun Pan Lab ZDB-LAB-131028-1 Chr: 7 2019-09-17
ZDB-ALT-190415-5 cas010 Small Deletion embryos treated with CRISPR1-itga4 Weijun Pan Lab ZDB-LAB-131028-1 Chr: 9 2019-09-17
ZDB-ALT-190416-2 cas011 cas011Tg Small Deletion embryos treated with CRISPR1-vcam1b Weijun Pan Lab ZDB-LAB-131028-1 Chr: 22 2019-09-17
ZDB-ALT-170621-4 cbg10Tg Damascus, zf714Tg Transgenic Insertion embryos treated with DNA Oates Lab ZDB-LAB-031017-1 Unmapped TgBAC(dld:dld-Venus) ZDB-TGCONSTRCT-170621-2 2019-09-17
ZDB-ALT-170621-5 cbg11Tg Dover, zf715Tg Transgenic Insertion embryos treated with DNA Oates Lab ZDB-LAB-031017-1 Unmapped TgBAC(dld:dld-Venus) ZDB-TGCONSTRCT-170621-2 2019-09-17
ZDB-ALT-190123-675 cbg12Tg Transgenic Insertion embryos treated with DNA Norden Lab ZDB-LAB-120601-2 Unmapped Tg(actb2:EGFP-Hsa.PCNA) ZDB-TGCONSTRCT-190123-3 2019-09-17
ZDB-ALT-190123-676 cbg13Tg Transgenic Insertion embryos treated with DNA Norden Lab ZDB-LAB-120601-2 Unmapped Tg(actb2:EGFP-Rno.Tmpo) ZDB-TGCONSTRCT-190123-4 2019-09-17
ZDB-ALT-141105-1 cbg1Tg Looping Transgenic Insertion embryos treated with DNA Oates Lab ZDB-LAB-031017-1 Unmapped TgBAC(her1:Venus) ZDB-TGCONSTRCT-141105-1 2019-09-17
ZDB-ALT-150109-1 cbg2Tg Transgenic Insertion embryos treated with DNA Huisken Lab ZDB-LAB-100630-2 Unmapped Tg2(myl7:GAL4) ZDB-TGCONSTRCT-150108-1 2019-09-17
ZDB-ALT-160224-1 cbg3Tg Transgenic Insertion embryos treated with DNA Norden Lab ZDB-LAB-120601-2 Unmapped Tg(hsp70l:Hsa.PLK4-MKATE2) ZDB-TGCONSTRCT-160224-1 2019-09-17
ZDB-ALT-160224-2 cbg4Tg Transgenic Insertion embryos treated with DNA Norden Lab ZDB-LAB-120601-2 Unmapped Tg(hsp70l:Hsa.HIST1H2BJ-RFP) ZDB-TGCONSTRCT-160224-2 2019-09-17
ZDB-ALT-170113-1 cbg5Tg Transgenic Insertion embryos treated with DNA Norden Lab ZDB-LAB-120601-2 Unmapped Tg(actb2:EGFP-Hsa.DCX) ZDB-TGCONSTRCT-170113-2 2019-09-17
ZDB-ALT-170113-2 cbg6Tg Transgenic Insertion embryos treated with DNA Norden Lab ZDB-LAB-120601-2 Unmapped Tg(hsp70l:MKATE2-prkci-CAAX) ZDB-TGCONSTRCT-170113-1 2019-09-17
ZDB-ALT-171218-1 cbg7Tg Transgenic Insertion embryos treated with DNA Norden Lab ZDB-LAB-120601-2 Unmapped Tg(actb2:RFP-pcna) ZDB-TGCONSTRCT-171218-1 2019-09-17
ZDB-ALT-180125-2 cbg8Tg Transgenic Insertion embryos treated with DNA Norden Lab ZDB-LAB-120601-2 Unmapped Tg(actb2:MKATE2-Hsa.HRAS) ZDB-TGCONSTRCT-180125-1 2019-09-17
ZDB-ALT-180320-10 cbg9Tg Transgenic Insertion embryos treated with DNA Elisabeth Knust Lab ZDB-LAB-180319-2 Unmapped TgBAC(opn1lw1:opn1lw1-mNeonGreen,opn1lw2:opn1lw2-MKATE2) ZDB-TGCONSTRCT-180302-2 2019-09-17
ZDB-ALT-180208-1 cbm10Tg Transgenic Insertion embryos treated with DNA Bovolenta Lab ZDB-LAB-141112-1 Unmapped Tg(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.SIX6-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-180208-1 2019-09-17
ZDB-ALT-180208-2 cbm11Tg Transgenic Insertion embryos treated with DNA Bovolenta Lab ZDB-LAB-141112-1 Unmapped Tg2(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.SIX6-LOXP-gata2a:EGFP) ZDB-TGCONSTRCT-180208-2 2019-09-17
ZDB-ALT-051111-4 cc1Tg cc1, Tg(Plp1:EGFP), Tg(Plp1:EGFP)cc1 Transgenic Insertion embryos treated with DNA Macklin Lab ZDB-LAB-051017-1 Unmapped Tg(Mmu.Plp1:EGFP) ZDB-TGCONSTRCT-070117-20 2019-09-17
ZDB-ALT-080108-2 ccdc103_unspecified smh_unspecified, un_smh, unspecified_smh Unspecified Chr: 3 2019-09-17
ZDB-ALT-190311-3 ccu1Tg Transgenic Insertion embryos treated with DNA Visio to Action - Orger Lab ZDB-LAB-190311-2 Unmapped Tg(UAS:GCaMP6f) ZDB-TGCONSTRCT-190311-4 2019-09-17
ZDB-ALT-160819-1 cdf1Tg Transgenic Insertion embryos treated with DNA Regeneration and morphogenesis in zebrafish ZDB-LAB-121127-1 Unmapped Tg(ubb:HyPer) ZDB-TGCONSTRCT-160819-1 2019-09-17
ZDB-ALT-171006-2 cdf2Tg Transgenic Insertion embryos treated with DNA Regeneration and morphogenesis in zebrafish ZDB-LAB-121127-1 Unmapped Tg(Xla.Cryg:CFP,Hsa.EEF1A-4xHsa.U6:Gst.tRNACUA,ubb:AzFRs-FLAG-mCherry-2A-EGFP_Y145amb-NLS) ZDB-TGCONSTRCT-171006-2 2019-09-17
ZDB-ALT-050819-10 cdh23_unspecified un_cdh23, unspecified_cdh23, un_spu Unspecified Chr: 13 2019-09-17
ZDB-ALT-050316-2 cdh2_unspecified un_cdh2, un_ncad, unspecified_cdh2 Unspecified Chr: 20 2019-09-17
ZDB-ALT-180409-1 ced1Tg Transgenic Insertion embryos treated with DNA Kizil Lab, Mechanisms of induced Plasticity of the Vertebrate Brain ZDB-LAB-140417-2 Unmapped Tg(ubb:LOXP-DsRed-LOXP-GFP-t2A-Hsa.TAU_P301L) ZDB-TGCONSTRCT-180604-3 2019-09-17
ZDB-ALT-180409-2 ced2Tg Transgenic Insertion embryos treated with DNA Kizil Lab, Mechanisms of induced Plasticity of the Vertebrate Brain ZDB-LAB-140417-2 Unmapped Tg(Xla.Tubb:mCherry-T2A-Cre-ERT2) ZDB-TGCONSTRCT-180409-2 2019-09-17
ZDB-ALT-070122-3 celsr2_unspecified un_celsr2, un_ord, unspecified_celsr2 Unspecified Chr: 22 2019-09-17
ZDB-ALT-111010-1 celsr3_unrecovered Point Mutation adult males treated with ENU Chr: 8 2019-09-17
ZDB-ALT-091027-9 cep290_unrecovered un_cep290, unrec_cep290, unrecovered_cep290 Point Mutation adult males treated with ENU Chr: 25 2019-09-17
ZDB-ALT-051110-4 cf1Tg cf1, Tg(elavl3:IP), Tg(elavl3:IP)cf1 Transgenic Insertion embryos treated with DNA Joe Fetcho Lab ZDB-LAB-970909-135 Unmapped Tg(elavl3:IP) ZDB-TGCONSTRCT-070117-35 2019-09-17
ZDB-ALT-051110-2 cf2Tg cf2, Tg(elavl3:YC), Tg(elavl3:YC)cf2 Transgenic Insertion embryos treated with DNA Joe Fetcho Lab ZDB-LAB-970909-135 Unmapped Tg(elavl3:YC2) ZDB-TGCONSTRCT-070117-151 2019-09-17
ZDB-ALT-070514-1 cf3Tg Tg(slc6a5:GFP)cf3 Transgenic Insertion embryos treated with DNA Joe Fetcho Lab ZDB-LAB-970909-135 Unmapped Tg(slc6a5:GFP) ZDB-TGCONSTRCT-070514-1 2019-09-17
ZDB-ALT-070514-2 cf4Tg Tg(slc6a5:GFP)cf4 Transgenic Insertion embryos treated with DNA Joe Fetcho Lab ZDB-LAB-970909-135 Unmapped Tg(slc6a5:GFP) ZDB-TGCONSTRCT-070514-1 2019-09-17
ZDB-ALT-190523-1 cf5Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR1-slc6a2, CRISPR2-slc6a2 Insertion occurred 6 bp upstream of the genomic DNA PAM site. Joe Fetcho Lab ZDB-LAB-970909-135 Chr: 7 Tg(hsp70l:Rno.Gap43-MA-TdTomato) ZDB-TGCONSTRCT-190523-3 2019-09-17
ZDB-ALT-190523-2 cf6Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR1-slc6a2, CRISPR2-slc6a2 Insertion occurred 7 bp upstream of the genomic DNA PAM site. Joe Fetcho Lab ZDB-LAB-970909-135 Chr: 7 Tg(hsp70l:gap43-MA-ECFP) ZDB-TGCONSTRCT-190523-2 2019-09-17
ZDB-ALT-190523-3 cf7Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR1-slc6a2, CRISPR2-slc6a2 Insertion occurred 24 base pairs upstream of the target PAM site, and a small indel is present. Joe Fetcho Lab ZDB-LAB-970909-135 Chr: 7 Tg(hsp70l:Hsa.H2B-GCaMP6f) ZDB-TGCONSTRCT-190523-4 2019-09-17
ZDB-ALT-110201-1 ch100Tg Tg(isl1-hsp70l:mRFP)ch100, Tg(zCREST1:membRFP) Transgenic Insertion embryos treated with DNA Membrane-targeted RFP is driven by the branchiomotor neuron-specific zCREST1 enhancer of the islet1 promoter. Prince Lab ZDB-LAB-971216-15 Unmapped Tg(isl1-hsp70l:mRFP) ZDB-TGCONSTRCT-110201-1 2019-09-17
ZDB-ALT-110725-2 ch101Tg Tg(-1.0ins:Hsa.INS-GFP)ch101 Transgenic Insertion embryos treated with DNA Prince Lab ZDB-LAB-971216-15 Unmapped Tg(-1.0ins:Hsa.INS-GFP) ZDB-TGCONSTRCT-110725-2 2019-09-17
ZDB-ALT-110725-3 ch102Tg Tg(-1.0ins:Hsa.INS_C43G-GFP)ch102 Transgenic Insertion DNA Prince Lab ZDB-LAB-971216-15 Unmapped Tg(-1.0ins:Hsa.INS_C43G-GFP) ZDB-TGCONSTRCT-110725-3 2019-09-17
ZDB-ALT-170424-6 ch103Tg Transgenic Insertion embryos treated with DNA Prince Lab ZDB-LAB-971216-15 Unmapped Tg(isl1-hsp70l:Kaede) ZDB-TGCONSTRCT-170424-2 2019-09-17
ZDB-ALT-170424-7 ch104Tg Transgenic Insertion embryos treated with DNA Prince Lab ZDB-LAB-971216-15 Unmapped 2019-09-17
ZDB-ALT-190206-3 ch105 Small Deletion embryos treated with CRISPR1-prickle1a Prince Lab ZDB-LAB-971216-15 Ambiguous 2019-09-17
ZDB-ALT-070920-2 ch1Tg Tg(hsp70l:cdx4)ch1 Transgenic Insertion DNA Robert Ho Lab ZDB-LAB-980414-2 Unmapped Tg(hsp70l:cdx4) ZDB-TGCONSTRCT-070920-2 2019-09-17
ZDB-ALT-170412-1 ch200 Small Deletion embryos treated with TALEN1-ythdf2 8 bp deletion upstream of the YTH RNA-binding domain Chuan He Lab ZDB-LAB-170412-1 Chr: 17 2019-09-17
ZDB-ALT-160517-1 ch2Tg This feature is representative of one or more unknown insertion sites. Et(hand2:eGFP) Transgenic Insertion embryos treated with DNA The transposon insertion site in Et(hand2:eGFP)ch2 is mapped at the 5’ UTR of hand2. Robert Ho Lab ZDB-LAB-980414-2 Chr: 1 Tg2(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-151015-1 2019-09-17
ZDB-ALT-190703-4 ch3 Insertion embryos treated with CRISPR1-tbx5b The 4 bp insertion in the first intron would result in a splicing error where the first intron is not spliced from the protein, leading to a frameshift starting at amino acid 53 and a premature stop codon after 16 incorrect amino acids. The protein would be truncated before the highly conserved TBOX and likely be completely nonfunctional. Robert Ho Lab ZDB-LAB-980414-2 Chr: 5 2019-09-17
ZDB-ALT-190321-1 ch300Tg zf2057Tg Transgenic Insertion Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(en.island1-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190321-1 2019-09-17
ZDB-ALT-190321-3 ch301Tg zf2059Tg Transgenic Insertion embryos treated with DNA Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(Loc.Island1-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190321-2 2019-09-17
ZDB-ALT-190321-4 ch302Tg zf2060Tg Transgenic Insertion embryos treated with DNA Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(Loc.E16-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190321-3 2019-09-17
ZDB-ALT-190321-2 ch303Tg zf2058Tg Transgenic Insertion embryos treated with DNA Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(Loc.Csb-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190321-4 2019-09-17
ZDB-ALT-190321-5 ch304Tg zf2061Tg Transgenic Insertion embryos treated with DNA Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(Mmu.Island1-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190321-5 2019-09-17
ZDB-ALT-190321-6 ch305Tg zf2062Tg Transgenic Insertion embryos treated with DNA Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(Mmu.Island2-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190321-6 2019-09-17
ZDB-ALT-190321-7 ch306Tg zf2063Tg Transgenic Insertion embryos treated with DNA Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(Mmu.Island4-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190321-7 2019-09-17
ZDB-ALT-190820-2 ch307 Complex embryos treated with CRISPR1-hoxa13a, CRISPR2-hoxa13a Contains both a -5 bp deletion and a -3 bp deletion. Shubin Lab ZDB-LAB-150427-2 Unmapped 2019-09-17
ZDB-ALT-190820-1 ch308 Insertion embryos treated with CRISPR1-hoxa13b, CRISPR2-hoxa13b Shubin Lab ZDB-LAB-150427-2 Chr: 16 2019-09-17
ZDB-ALT-190820-3 ch309Tg Transgenic Insertion embryos treated with DNA Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(4xLoc.e16:Cre) ZDB-TGCONSTRCT-190820-3 2019-09-17
ZDB-ALT-190820-4 ch310Tg Transgenic Insertion embryos treated with DNA Shubin Lab ZDB-LAB-150427-2 Unmapped Tg(3xnccr.65:Cre) ZDB-TGCONSTRCT-190820-2 2019-09-17
ZDB-ALT-110720-1 chb1Tg Tg(myl7:mCherry)chb1 Transgenic Insertion embryos treated with DNA Mably Lab ZDB-LAB-050429-1 Unmapped Tg(myl7:mCherry) ZDB-TGCONSTRCT-110720-1 2019-09-17
ZDB-ALT-151215-6 chb2Tg Transgenic Insertion embryos treated with DNA Mably Lab ZDB-LAB-050429-1 Unmapped Tg(myl7:NLS-EGFP) ZDB-TGCONSTRCT-151215-5 2019-09-17
ZDB-ALT-160314-1 chi1 cd1 Small Deletion embryos treated with TALEN1-mib2 This allele is the result of an 8 bp deletion in exon 6 of the mib2 gene, resulting in a stop codon in the first ankyrin repeat domain, A538stop. Itoh Lab ZDB-LAB-160210-1 Chr: 8 2019-09-17
ZDB-ALT-160314-3 chi2 cd2 Complex embryos treated with TALEN1-mib2 This allele is the result of a 1 bp insertion and an 8 bp deletion in exon 6 of the mib2 gene, resulting in a stop codon in the first ankyrin repeat domain, Q531stop. Itoh Lab ZDB-LAB-160210-1 Chr: 8 2019-09-17
ZDB-ALT-160314-2 chi3 cd3 Small Deletion embryos treated with TALEN1-mib2 This allele is the result of an 8 bp deletion in exon 6 of the mib2 gene, resulting in a stop codon in the first ankyrin repeat domain, I536stop. Itoh Lab ZDB-LAB-160210-1 Chr: 8 2019-09-17
ZDB-ALT-161117-2 chi4Tg Transgenic Insertion embryos treated with DNA Itoh Lab ZDB-LAB-160210-1 Unmapped Tg(10xUAS:LIFEACT-mCherry) ZDB-TGCONSTRCT-161117-1 2019-09-17
ZDB-ALT-161117-3 chi6Tg Transgenic Insertion embryos treated with DNA Itoh Lab ZDB-LAB-160210-1 Unmapped Tg(10xUAS:Mmu.Mapre1-mCherry) ZDB-TGCONSTRCT-161117-2 2019-09-17
ZDB-ALT-161117-4 chi7Tg Transgenic Insertion embryos treated with DNA Itoh Lab ZDB-LAB-160210-1 Unmapped Tg(10xUAS:LIFEACT-EGFP) ZDB-TGCONSTRCT-161117-3 2019-09-17
ZDB-ALT-050209-34 chrd_unspecified chd_unspecified, un_chd, un_din, unspecified_chd Unspecified Chr: 15 2019-09-17
ZDB-ALT-131107-10 ci1001Tg cch1, Tg(actb2:GAL4-rarab)ci1001 Transgenic Insertion embryos treated with DNA Waxman Lab ZDB-LAB-100121-1 Unmapped Tg(actb2:GAL4-rarab) ZDB-TGCONSTRCT-131107-3 2019-09-17
ZDB-ALT-131107-12 ci1002Tg cch2, Tg(actb2:GAL4-VP16-rarab)ci1002 Transgenic Insertion embryos treated with DNA Waxman Lab ZDB-LAB-100121-1 Unmapped Tg(actb2:GAL4-VP16-rarab) ZDB-TGCONSTRCT-131107-4 2019-09-17
ZDB-ALT-131107-11 ci1004Tg cch4, Tg(actb2:GAL4-rarab)ci1004 Transgenic Insertion embryos treated with DNA Waxman Lab ZDB-LAB-100121-1 Unmapped Tg(actb2:GAL4-rarab) ZDB-TGCONSTRCT-131107-3 2019-09-17
ZDB-ALT-131107-13 ci1005Tg cch5, Tg(actb2:GAL4-VP16-rarab)ci1005 Transgenic Insertion embryos treated with DNA Waxman Lab ZDB-LAB-100121-1 Unmapped Tg(actb2:GAL4-VP16-rarab) ZDB-TGCONSTRCT-131107-4 2019-09-17
ZDB-ALT-131107-14 ci1006Tg cch6, Tg(actb2:GAL4-VP16-rarab)ci1006 Transgenic Insertion embryos treated with DNA Waxman Lab ZDB-LAB-100121-1 Unmapped Tg(actb2:GAL4-VP16-rarab) ZDB-TGCONSTRCT-131107-4 2019-09-17
ZDB-ALT-180606-10 ci1009 Small Deletion embryos treated with CRISPR1-nr2f1a Waxman Lab ZDB-LAB-100121-1 Chr: 5 2019-09-17
ZDB-ALT-151209-8 ci104Tg Transgenic Insertion embryos treated with DNA Waxman Lab ZDB-LAB-100121-1 Unmapped Tg(hsp70l:EGFP-VP16-dnrarab,cryaa:DsRed) ZDB-TGCONSTRCT-151209-3 2019-09-17
ZDB-ALT-190510-3 ci16 Small Deletion embryos treated with TALEN1-col22a1 Homozygous mutant embryos and larvae appear normal and are viable to adulthood. A fraction of homozygous mutant adults develop hemorrhages around the eyes. Mutant vasculature shows an increased susceptibility to hemorrhage under mechanical or thermal stress.; This mutation maps to a scaffold with the following coordinates KN150214.1:143922 - KN150214.1:143926. Sumanas Lab ZDB-LAB-110128-1 Unmapped 2019-09-17
ZDB-ALT-190510-4 ci18Tg Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped Tg(hsp70l:Hsa.COL22A1-2A-mCherry,cryaa:DsRed) ZDB-TGCONSTRCT-190510-5 2019-09-17
ZDB-ALT-110131-53 ci1Tg Tg(etv2:EGFP)ci1 Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped TgBAC(etv2:EGFP) ZDB-TGCONSTRCT-110131-44 2019-09-17
ZDB-ALT-181003-1 ci200 Indel embryos treated with CRISPR1-abcb11b Homozygotes begin to show increased mortality at 11 dpf. Very low survival to adulthood (2/54 = 3.7%) due to severely compromised liver function.; CRISPR/Cas9 mutagenesis was used to target the eighth exon of the abcb11b gene. The resulting ci200 allele has a 1-bp deletion, a 3-bp insertion, and a T to A nucleotide change. The mutation results in a frameshift and premature stop. The mutant protein is predicted to retain only the first transmembrane helix and the first extracellular loop but to lack the remaining 11 transmembrane helices and both nucleotide binding folds.
abcb11b_(WT)______ GGCATCGGAGCAGGGGTCTTCAT---TCTTGGATACCTCC
__________________ ********************_**___***_**********
abcb11b_(ci200)___ GGCATCGGAGCAGGGGTCTT-ATACCTCTAGGATACCTCC
Chunyue Yin Lab ZDB-LAB-121129-1 Chr: 11 2019-09-17
ZDB-ALT-181003-2 ci202Tg Transgenic Insertion embryos treated with DNA Chunyue Yin Lab ZDB-LAB-121129-1 Unmapped Tg(fabp10a:Hsa.ABCB11-GFP) ZDB-TGCONSTRCT-181003-1 2019-09-17
ZDB-ALT-160505-1 ci25Tg Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped Tg(hsp70l:vegfc,myl7:EGFP) ZDB-TGCONSTRCT-160505-1 2019-09-17
ZDB-ALT-180920-3 ci29Tg Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped Tg(fli1a:flt4-2A-mCherry) ZDB-TGCONSTRCT-180920-1 2019-09-17
ZDB-ALT-110131-54 ci2Tg Tg(etv2:EGFP)ci2 Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped TgBAC(etv2:EGFP) ZDB-TGCONSTRCT-110131-44 2019-09-17
ZDB-ALT-190510-5 ci31Tg Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped Tg(hsp70l:Hsa.COL22A1_E736D-2A-mCherry,cryaa:DsRed) ZDB-TGCONSTRCT-190510-6 2019-09-17
ZDB-ALT-110131-55 ci3Tg Tg(etv2:EGFP)ci3 Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped TgBAC(etv2:EGFP) ZDB-TGCONSTRCT-110131-44 2019-09-17
ZDB-ALT-110131-56 ci4Tg Tg(etv2:EGFP)ci4 Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped TgBAC(etv2:EGFP) ZDB-TGCONSTRCT-110131-44 2019-09-17
ZDB-ALT-110131-57 ci5Tg Tg(-6.5kdrl:mCherry)ci5 Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped Tg(-6.5kdrl:mCherry) ZDB-TGCONSTRCT-110131-46 2019-09-17
ZDB-ALT-130717-1 ci6Tg TgBAC(etv2:Kaede)ci6 Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped TgBAC(etv2:Kaede) ZDB-TGCONSTRCT-130717-1 2019-09-17
ZDB-ALT-151110-3 ci8Tg Transgenic Insertion embryos treated with DNA Sumanas Lab ZDB-LAB-110128-1 Unmapped Tg(fli1a:hand2-2A-mCherry) ZDB-TGCONSTRCT-151110-2 2019-09-17
ZDB-ALT-170425-1 cif1Tg Transgenic Insertion embryos treated with DNA Chaudhari Lab ZDB-LAB-170328-1 Unmapped Tg(Pvi.Mt1:DsRed) ZDB-TGCONSTRCT-170502-2 2019-09-17
ZDB-ALT-180522-2 cig1 Ma1 Small Deletion embryos treated with CRISPR1-mstna Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Chr: 22 2019-09-17
ZDB-ALT-180522-3 cig2 Ma2 Small Deletion embryos treated with CRISPR1-mstna Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Chr: 22 2019-09-17
ZDB-ALT-180522-4 cig3 Mb1 Small Deletion embryos treated with CRISPR1-mstnb Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Chr: 9 2019-09-17
ZDB-ALT-180615-2 cig4aTg This feature is representative of one or more unknown insertion sites. cig4Tg, CM2 Transgenic Insertion embryos treated with DNA The location of cyp1a:mCherry is on Chr.4 between tspan11 and sema3aa. It is 0.7 KB downstream of tspan11 and 10Kb upstream of sema3aa. Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Unmapped Tg(cyp1a:mCherry) ZDB-TGCONSTRCT-180615-2 2019-09-17
ZDB-ALT-180628-9 cig4bTg cig4Tg, CM2 Transgenic Insertion embryos treated with DNA The construct, cyp1a:mCherry, inserted in repetitive sequence. The sequence is found on chr. 4, 13 and 16 and the insertion may be at any of these sites. Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Unmapped Tg(cyp1a:mCherry) ZDB-TGCONSTRCT-180615-2 2019-09-17
ZDB-ALT-180615-3 cig5Tg This feature is representative of one or more unknown insertion sites. CM3 Transgenic Insertion embryos treated with DNA The insertion site is on Chr. 22 between elfn2a and mfng. It is located 23Kb downstream of elfn2a and 0.5 Kb upstream of mfng. Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Unmapped Tg(cyp1a:mCherry) ZDB-TGCONSTRCT-180615-2 2019-09-17
ZDB-ALT-181203-1 cig6Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR3-gfap Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Chr: 3 Tg(2A-mCherry) ZDB-TGCONSTRCT-181203-1 2019-09-17
ZDB-ALT-181203-2 cig7Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR1-fli1a Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Chr: 18 Tg(2A-mCherry) ZDB-TGCONSTRCT-181203-1 2019-09-17
ZDB-ALT-181203-3 cig8Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR3-gata1a Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Chr: 11 Tg(2A-mCherry) ZDB-TGCONSTRCT-181203-1 2019-09-17
ZDB-ALT-181203-8 cig9Tg Transgenic Insertion embryos treated with DNA Pei Lab, Research Center for Environment and Health (RCEH) ZDB-LAB-131003-1 Unmapped Tg2(cyp1a:mCherry) ZDB-TGCONSTRCT-181203-5 2019-09-17
ZDB-ALT-110705-4 cj100Tg Tg(be:mRFP)cj100, Tg(BmpRE:mRFP)cj100 Transgenic Insertion embryos treated with DNA Hill Lab ZDB-LAB-110602-1 Unmapped Tg(BMPRE:mRFP) ZDB-TGCONSTRCT-110705-4 2019-09-17
ZDB-ALT-080910-3 cj1Tg TgBAC_BX537304(her1:d1EGFP)cj1, TgBAC(her1:d1EGFP)cj1 Transgenic Insertion embryos treated with DNA Vertebrate Development Laboratory ZDB-LAB-011022-1 Unmapped TgBAC(her1:d1EGFP) ZDB-TGCONSTRCT-080910-2 2019-09-17
ZDB-ALT-111004-2 cj2Tg Tg(UAS:dlc)cj2 Transgenic Insertion embryos treated with DNA Vertebrate Development Laboratory ZDB-LAB-011022-1 Unmapped Tg(UAS:dlc) ZDB-TGCONSTRCT-111004-1 2019-09-17
ZDB-ALT-101026-1 cj3Tg cj2, MAZe, Tg(Xla.Ef1a:Gal4-VP16,hsp70l:Cre,UAS:nlsRFP)cj2, Tg(Xla.Ef1a:Gal4-VP16,hsp70l:Cre,UAS:nlsRFP)cj3 Transgenic Insertion embryos treated with DNA Vertebrate Development Laboratory ZDB-LAB-011022-1 Unmapped Tg(Xla.Ef1a:GAL4-VP16,hsp70l:Cre,UAS:NLS-RFP) ZDB-TGCONSTRCT-101026-1 2019-09-17
ZDB-ALT-140508-1 cj4Tg Transgenic Insertion embryos treated with DNA Vertebrate Development Laboratory ZDB-LAB-011022-1 Unmapped Tg(UAS:HA-Xla.Ctnnb) ZDB-TGCONSTRCT-140508-1 2019-09-17
ZDB-ALT-180307-1 ck001a cnu1 Small Deletion embryos treated with zinc finger nuclease Cheol-Hee Kim Lab ZDB-LAB-020703-1 Unmapped 2019-09-17
ZDB-ALT-180307-2 ck001b cnu2 Small Deletion embryos treated with zinc finger nuclease Cheol-Hee Kim Lab ZDB-LAB-020703-1 Unmapped 2019-09-17
ZDB-ALT-181004-1 ck004a cnu004a Small Deletion embryos treated with zinc finger nuclease The 23 bp deletion is predicted to result in the loss of all functional domains of the protein. Cheol-Hee Kim Lab ZDB-LAB-020703-1 Ambiguous 2019-09-17
ZDB-ALT-160817-4 ck018 Small Deletion embryos treated with TALEN1-mcrs1 Cheol-Hee Kim Lab ZDB-LAB-020703-1 Chr: 11 2019-09-17
ZDB-ALT-151105-5 ck035a cnu035a Small Deletion embryos treated with TALEN1-zc4h2 treatment with TALENs created a 11 bp deleton in the zc4h2 gene that caused a frameshift mutation leading to a truncated protein. Cheol-Hee Kim Lab ZDB-LAB-020703-1 Ambiguous 2019-09-17
ZDB-ALT-151105-6 ck035b cnu035b Small Deletion embryos treated with TALEN1-zc4h2 treatment with TALENs created a 2 bp deleton in the zc4h2 gene that caused a frameshift mutation leading to a truncated protein. Cheol-Hee Kim Lab ZDB-LAB-020703-1 Ambiguous 2019-09-17
ZDB-ALT-170119-6 ck112a Insertion embryos treated with CRISPR1-tyr protein truncated in the EGF-like somain Cheol-Hee Kim Lab ZDB-LAB-020703-1 Chr: 15 2019-09-17
ZDB-ALT-110127-7 ck1Tg Tg(mbp:EGFP)ck1 Transgenic Insertion embryos treated with DNA Cheol-Hee Kim Lab ZDB-LAB-020703-1 Unmapped Tg(mbp:EGFP) ZDB-TGCONSTRCT-110127-5 2019-09-17
ZDB-ALT-130614-1 ck2Tg Tg(eef1a1l1:Kaede)ck2 Transgenic Insertion embryos treated with DNA Cheol-Hee Kim Lab ZDB-LAB-020703-1 Unmapped Tg(eef1a1l1:Kaede) ZDB-TGCONSTRCT-130614-1 2019-09-17
ZDB-ALT-150714-1 ck3Tg Transgenic Insertion embryos treated with DNA Cheol-Hee Kim Lab ZDB-LAB-020703-1 Unmapped Tg(-2.2col10a1a:GFP) ZDB-TGCONSTRCT-150714-1 2019-09-17
ZDB-ALT-150205-3 ck4Tg Transgenic Insertion embryos treated with DNA Cheol-Hee Kim Lab ZDB-LAB-020703-1 Unmapped Tg(hsp70l:vegfaa) ZDB-TGCONSTRCT-150205-3 2019-09-17
ZDB-ALT-150122-2 cku1Tg Transgenic Insertion embryos treated with DNA TF Fu Lab ZDB-LAB-150122-1 Unmapped Tg(hsp70l:EGFP-ggh) ZDB-TGCONSTRCT-150122-1 2019-09-17
ZDB-ALT-150122-3 cku2Tg Transgenic Insertion embryos treated with DNA TF Fu Lab ZDB-LAB-150122-1 Unmapped Tg(hsp70l:EGFP-ggh_108C>A) ZDB-TGCONSTRCT-150122-2 2019-09-17
ZDB-ALT-150122-4 cku3Tg Transgenic Insertion embryos treated with DNA TF Fu Lab ZDB-LAB-150122-1 Unmapped Tg(hsp70l:EGFP-ggh,fabp10a:mCherry) ZDB-TGCONSTRCT-150122-3 2019-09-17
ZDB-ALT-110429-5 cl100 sapje-like Point Mutation adult males treated with ENU This allele has a G to A base change in the exon 62 donor splice junction of dystrophin (dmd). Kunkel Lab ZDB-LAB-131009-1 Chr: 1 2019-09-17
ZDB-ALT-131010-1 cl101Tg Tg(-2.2myl7:mir199-001)cl101 Transgenic Insertion embryos treated with DNA Kunkel Lab ZDB-LAB-131009-1 Unmapped Tg(-2.2myl7:mir199-001) ZDB-TGCONSTRCT-131010-1 2019-09-17
ZDB-ALT-190813-1 cl102Tg Transgenic Insertion embryos treated with DNA Kunkel Lab ZDB-LAB-131009-1 Unmapped Tg(mylpfa:LOXP-EGFP-LOXP-Hsa.DUX4-mCherry,mylpfa:EGFP) ZDB-TGCONSTRCT-190813-1 2019-09-17
ZDB-ALT-170608-19 cl201 Insertion embryos treated with CRISPR3-mymk dn9 chr5:68937959insT; Exon 3 insertion of T at position c.434. This causes a predicted frameshift 33 aminmo acids after p.Val106 Engle Lab ZDB-LAB-170531-1 Chr: 5 2019-09-17
ZDB-ALT-110816-1 cl500 patchytail Point Mutation adult males treated with ENU The point mutation identified in patchytail dag1-mutated fish (c.1700T>A) results in a missense amino acid change of valine (V) to aspartic acid (D) (p.V567D). This change is present in the C-terminal domain of alpha-dystroglycan that is required for DGC (dystrophin-glycoprotein complex) assembly by interacting with the C-terminal domain of beta-dystroglycan.
( adapted from Gupta et al. 2011 ) Beggs Lab ZDB-LAB-110606-2 Chr: 22 2019-09-17
ZDB-ALT-110816-2 cl501 candyfloss Point Mutation adult males treated with ENU G to A transition at a donor splice site in intron 33. Beggs Lab ZDB-LAB-110606-2 Chr: 20 2019-09-17
ZDB-ALT-180410-2 cl600 Small Deletion embryos treated with CRISPR1-osgep Guide RNA 3 against osgep (NM_001017751.2) induced a deletion of 10 bp in Exon 2 (c.169_178del) resulting in a truncated protein (p.Gln58Serfs*6). Hildebrandt Lab ZDB-LAB-180327-2 Chr: 4 2019-09-17
ZDB-ALT-180410-3 cl601 Small Deletion embryos treated with CRISPR3-tprkb Guide RNA 2 against tprkb (NM_001007373.1) induced a deletion of 29 bp in Exon 2 (c.356_384del) resulting in a truncated protein (p.Ile119Thrfs*4). Hildebrandt Lab ZDB-LAB-180327-2 Chr: 4 2019-09-17
ZDB-ALT-180625-5 cl602 Small Deletion embryos treated with CRISPR2-osgep, CRISPR3-osgep, CRISPR4-osgep Hildebrandt Lab ZDB-LAB-180327-2 Chr: 4 2019-09-17
ZDB-ALT-180625-6 cl603 Indel embryos treated with CRISPR2-tprkb, CRISPR4-tprkb, CRISPR5-tprkb Hildebrandt Lab ZDB-LAB-180327-2 Chr: 4 2019-09-17
ZDB-ALT-180629-3 cl604 Indel Hildebrandt Lab ZDB-LAB-180327-2 Unmapped 2019-09-17
ZDB-ALT-180629-4 cl605 Indel Hildebrandt Lab ZDB-LAB-180327-2 Unmapped 2019-09-17
ZDB-ALT-180629-5 cl606 Indel Hildebrandt Lab ZDB-LAB-180327-2 Unmapped 2019-09-17
ZDB-ALT-180629-6 cl607 Indel Hildebrandt Lab ZDB-LAB-180327-2 Unmapped 2019-09-17
ZDB-ALT-180629-7 cl608 Small Deletion Hildebrandt Lab ZDB-LAB-180327-2 Unmapped 2019-09-17
ZDB-ALT-180629-8 cl609 Small Deletion Hildebrandt Lab ZDB-LAB-180327-2 Unmapped 2019-09-17
ZDB-ALT-091027-54 cldn15lb_unrecovered un_cldn10l1b, unrec_cldn10l1b, unrec_cldn15lb, unrecovered_cldn15lb, unrec_zgc92349 Point Mutation adult males treated with ENU Chr: 15 2019-09-17
ZDB-ALT-020313-4 cm1 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020315-2 cm10 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-2 cm11 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-4 cm12 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-6 cm13 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-8 cm14 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-10 cm15 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-12 cm16 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-14 cm17 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-16 cm18 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-18 cm19 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020313-2 cm2 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-20 cm20 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-22 cm21 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020315-4 cm22 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-24 cm23 Unknown McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-26 cm24 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-32 cm25 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-28 cm26 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020314-30 cm27 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020313-6 cm3 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020313-8 cm4 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020313-10 cm5 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020313-12 cm6 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020313-14 cm7 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020313-16 cm8 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-020313-18 cm9 Unknown spontaneous McCune Lab ZDB-LAB-020313-1 Unmapped 2019-09-17
ZDB-ALT-180503-2 cmg35 Small Deletion embryos treated with CRISPR1-brca2 c.534del13
p.V178fs Center for Medical Genetics Ghent (CMGG) ZDB-LAB-151106-1 Chr: 15 2019-09-17
ZDB-ALT-190206-2 cmr1Tg Transgenic Insertion embryos treated with DNA Raya Lab ZDB-LAB-130114-1 Unmapped Tg(actb2:ERT2-Cre-ERT2) ZDB-TGCONSTRCT-190206-2 2019-09-17
ZDB-ALT-090309-2 cms1Tg Tg(XlEef1a1:mlsEGFP)zf130, zf130Tg Transgenic Insertion embryos treated with DNA Seok-Yong Choi Lab ZDB-LAB-151008-5 Unmapped Tg(Xla.Eef1a1:mlsEGFP) ZDB-TGCONSTRCT-090309-1 2019-09-17
ZDB-ALT-151012-1 cms2Tg Transgenic Insertion embryos treated with DNA Seok-Yong Choi Lab ZDB-LAB-151008-5 Unmapped TgBAC(cyp1a:NLS-EGFP) ZDB-TGCONSTRCT-150928-7 2019-09-17
ZDB-ALT-170711-13 cn10Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(-6.8wt1a:Cre-ERT2) ZDB-TGCONSTRCT-170711-9 2019-09-17
ZDB-ALT-170711-14 cn11Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(col1a2:LOXP-mCherry-NTR) ZDB-TGCONSTRCT-170711-10 2019-09-17
ZDB-ALT-170823-7 cn12Et Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Et(-26.5Hsa.WT1-gata2a:EGFP) ZDB-ETCONSTRCT-170823-1 2019-09-17
ZDB-ALT-171107-1 cn13Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(tbx5a:tdTomato) ZDB-TGCONSTRCT-171107-1 2019-09-17
ZDB-ALT-180604-1 cn14Tg Tg(GFP-5xUAS-wt1bDN;cryaa:eCFP) Transgenic Insertion Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(5xUAS:wt1b,GFP,cryaa:ECFP) ZDB-TGCONSTRCT-190724-5 2019-09-17
ZDB-ALT-190528-2 cn15Tg Tg(GFP-5xUAS-RFP;cryaa:eCFP) Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(5xUAS:GFP,RFP,cryaa:ECFP) ZDB-TGCONSTRCT-190724-4 2019-09-17
ZDB-ALT-190528-3 cn16Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(mpeg1.1:mCherry,cryaa:mCherry) ZDB-TGCONSTRCT-190724-6 2019-09-17
ZDB-ALT-131231-1 cn1Et cn1Tg, Et(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.WT1-LOXP-gata2a:EGFP-5HS4)cn1 Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Et(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.WT1-LOXP-gata2a:EGFP-5HS4) ZDB-ETCONSTRCT-131231-1 2019-09-17
ZDB-ALT-151222-4 cn2Tg Hulk Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(-3.5ubb:LOXP-LacZ-LOXP-egfp) ZDB-TGCONSTRCT-151222-1 2019-09-17
ZDB-ALT-161004-1 cn3Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(tbx5a:Cre-ERT2) ZDB-TGCONSTRCT-161004-1 2019-09-17
ZDB-ALT-161004-2 cn4Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(tbx5a:mCherry-2A-Cre-ERT2) ZDB-TGCONSTRCT-161004-2 2019-09-17
ZDB-ALT-170711-2 cn5Tg Tg(vmhcl:LOXP-MYC-BFP-STOP-LOXP-NTR-mCherry) Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(myh7l:LOXP-MYC-BFP-STOP-LOXP-NTR-mCherry) ZDB-TGCONSTRCT-161004-3 2019-09-17
ZDB-ALT-170711-3 cn6Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(postnb:Citrine) ZDB-TGCONSTRCT-180131-1 2019-09-17
ZDB-ALT-170711-4 cn7Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(postnb:Cre-ERT2) ZDB-TGCONSTRCT-180131-2 2019-09-17
ZDB-ALT-170711-11 cn8Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(col1a2:LOXP-TagBFP-LOXP-mCherry-NTR) ZDB-TGCONSTRCT-170711-7 2019-09-17
ZDB-ALT-170711-12 cn9Tg Transgenic Insertion embryos treated with DNA Mercader Lab ZDB-LAB-121205-1 Unmapped Tg(fli1a:Cre-ERT2) ZDB-TGCONSTRCT-170711-8 2019-09-17
ZDB-ALT-140402-3 cnu1Tg Transgenic Insertion embryos treated with DNA CF Ken Lab ZDB-LAB-140226-1 Unmapped Tg(fabp10a:cpYFP) ZDB-TGCONSTRCT-140326-2 2019-09-17
ZDB-ALT-190906-3 co1000 Allele #2 Small Deletion embryos treated with TALEN1-pcdh10a Artinger Lab ZDB-LAB-030703-1 Chr: 1 2019-09-17
ZDB-ALT-190314-6 co1007 ALLELE # 1 Complex embryos treated with TALEN1-kat2a This line contains both a deletion and a point mutation. Artinger Lab ZDB-LAB-030703-1 Chr: 3 2019-09-17
ZDB-ALT-190314-7 co1008 Allele #1 Complex embryos treated with CRISPR1-kat2b This line contains two indel (insertion and deletion) mutations. Artinger Lab ZDB-LAB-030703-1 Chr: 19 2019-09-17
ZDB-ALT-190906-4 co1009 Allele #1 Small Deletion embryos treated with CRISPR1-pcdh10b Artinger Lab ZDB-LAB-030703-1 Chr: 14 2019-09-17
ZDB-ALT-130212-5 co10Tg Tg(hand2:mCherry,myl7:EGFP)co10 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(hand2:mCherry,myl7:EGFP) ZDB-TGCONSTRCT-130212-2 2019-09-17
ZDB-ALT-130212-6 co11Tg Tg(hand2:mCherry,myl7:EGFP)co11 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(hand2:mCherry,myl7:EGFP) ZDB-TGCONSTRCT-130212-2 2019-09-17
ZDB-ALT-130212-7 co12Tg Tg(hand2:mCherry,myl7:EGFP)co12 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(hand2:mCherry,myl7:EGFP) ZDB-TGCONSTRCT-130212-2 2019-09-17
ZDB-ALT-141024-2 co14Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(hsp70l:pard3ab-EGFP) ZDB-TGCONSTRCT-141024-2 2019-09-17
ZDB-ALT-140414-2 co15Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(hsp70l:dnnotch3-EGFP) ZDB-TGCONSTRCT-140414-2 2019-09-17
ZDB-ALT-140414-3 co17Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(hsp70l:canotch3-EGFP) ZDB-TGCONSTRCT-140414-3 2019-09-17
ZDB-ALT-140722-8 co18Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(4xUAS:EGFP-CAAX,myl7:EGFP) ZDB-TGCONSTRCT-140722-4 2019-09-17
ZDB-ALT-140722-9 co19Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(sox10:GAL4-VP16,myl7:Cerulean) ZDB-TGCONSTRCT-140722-3 2019-09-17
ZDB-ALT-150728-1 co20Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(mbpa:GAL4-VP16,myl7:Cerulean) ZDB-TGCONSTRCT-150728-1 2019-09-17
ZDB-ALT-150728-2 co21Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(phox2bb:GAL4-VP16,myl7:Cerulean) ZDB-TGCONSTRCT-150728-4 2019-09-17
ZDB-ALT-150728-3 co22Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(4xnrUAS:mCherry-CAAX,myl7:EGFP) ZDB-TGCONSTRCT-150728-5 2019-09-17
ZDB-ALT-151207-1 co23Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(neurod1:tetxlc) ZDB-TGCONSTRCT-151207-1 2019-09-17
ZDB-ALT-190408-7 co25Tg zf2100Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(mbpa:TagRFPT) ZDB-TGCONSTRCT-190408-2 2019-09-17
ZDB-ALT-150316-1 co26Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped Tg(sox10:TagRFP) ZDB-TGCONSTRCT-150316-1 2019-09-17
ZDB-ALT-190409-2 co28Tg Transgenic Insertion embryos treated with DNA Appel Lab ZDB-LAB-020513-1 Unmapped TgBAC(cspg4:mCherry) ZDB-TGCONSTRCT-190409-3 2019-09-17
ZDB-ALT-130212-1 co3Tg Tg(hand2:TagRFP,myl7:EGFP)co3 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(hand2:TagRFP,myl7:EGFP) ZDB-TGCONSTRCT-130212-1 2019-09-17
ZDB-ALT-130212-2 co4Tg Tg(hand2:TagRFP,myl7:EGFP)co4 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(hand2:TagRFP,myl7:EGFP) ZDB-TGCONSTRCT-130212-1 2019-09-17
ZDB-ALT-130212-3 co5Tg Tg(hand2:TagRFP,myl7:EGFP)co5 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(hand2:TagRFP,myl7:EGFP) ZDB-TGCONSTRCT-130212-1 2019-09-17
ZDB-ALT-130212-4 co6Tg Tg(hand2:TagRFP,myl7:EGFP)co6 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(hand2:TagRFP,myl7:EGFP) ZDB-TGCONSTRCT-130212-1 2019-09-17
ZDB-ALT-181022-4 co7002 105 Small Deletion embryos treated with TALEN3-isl2a The mutant protein is predicted to lack the homeobox domain, the LIM2 domain, and part of the LIM1 domain. Mutants are homozygous viable. Ribera Lab ZDB-LAB-970409-121 Chr: 25 2019-09-17
ZDB-ALT-181112-11 co7003 102 Small Deletion embryos treated with TALEN3-isl2a This allele has a frameshift in exon 2, leading to a downstream premature stop codon. Mutants are homozygous viable. Ribera Lab ZDB-LAB-970409-121 Chr: 25 2019-09-17
ZDB-ALT-130212-8 co7Tg Tg(Mmu.Hand2:EGFP)co7 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(Mmu.Hand2:EGFP) ZDB-TGCONSTRCT-130212-3 2019-09-17
ZDB-ALT-130212-9 co8Tg Tg(Mmu.Hand2:EGFP)co8 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(Mmu.Hand2:EGFP) ZDB-TGCONSTRCT-130212-3 2019-09-17
ZDB-ALT-130212-10 co9Tg Tg(Mmu.Hand2:EGFP)co9 Transgenic Insertion embryos treated with DNA Clouthier Lab ZDB-LAB-130211-1 Unmapped Tg(Mmu.Hand2:EGFP) ZDB-TGCONSTRCT-130212-3 2019-09-17
ZDB-ALT-051227-2 col19a1_unspecified sty_unspecified, unspecified_sty, un_sty Unspecified Chr: 13 2019-09-17
ZDB-ALT-101008-3 col4a1_unrecovered unrec_col4a1, unrecovered_col4a1 Point Mutation adult males treated with ENU Chr: 9 2019-09-17
ZDB-ALT-101008-4 col4a3_unrecovered unrec_col4a3, unrecovered_col4a3 Point Mutation adult males treated with ENU Chr: 15 2019-09-17
ZDB-ALT-081031-3 cpt_unspecified un_cpt, unspecified_cpt Unspecified Unmapped 2019-09-17
ZDB-ALT-181105-5 cpu1Tg cpu1, zf2009Tg Transgenic Insertion embryos treated with DNA Jing Shang Lab ZDB-LAB-190521-1 Unmapped Tg(tyrp1a:EGFP) ZDB-TGCONSTRCT-181105-2 2019-09-17
ZDB-ALT-181105-6 cpu2 cpu2, zf2010 Small Deletion embryos treated with CRISPR1-htr1aa Jing Shang Lab ZDB-LAB-190521-1 Chr: 8 2019-09-17
ZDB-ALT-180306-4 cq10Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(kdrl:Dendra2-NTR) ZDB-TGCONSTRCT-180306-2 2019-09-17
ZDB-ALT-180306-5 cq11Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(kdrl:LIFEACT-DsRed) ZDB-TGCONSTRCT-180306-3 2019-09-17
ZDB-ALT-180306-6 cq12Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(coro1a:LIFEACT-DsRed) ZDB-TGCONSTRCT-180306-4 2019-09-17
ZDB-ALT-180306-7 cq13Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(kdrl:Hsa.MAPRE3-GFP) ZDB-TGCONSTRCT-180306-5 2019-09-17
ZDB-ALT-160707-5 cq16 Point Mutation adult males treated with ENU Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 5 2019-09-17
ZDB-ALT-180307-9 cq17Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(kdrl:RaichuEV) ZDB-TGCONSTRCT-180307-3 2019-09-17
ZDB-ALT-180307-10 cq18Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(coro1a:RaichuEV) ZDB-TGCONSTRCT-180307-4 2019-09-17
ZDB-ALT-180306-8 cq19Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(kdrl:GCaMP5) ZDB-TGCONSTRCT-180306-6 2019-09-17
ZDB-ALT-150922-3 cq1Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(fabp10a:Dendra2-NTR) ZDB-TGCONSTRCT-150922-2 2019-09-17
ZDB-ALT-180307-7 cq20Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(coro1a:Hsa.PAK1-Hsa.KRAS) ZDB-TGCONSTRCT-180307-1 2019-09-17
ZDB-ALT-180307-8 cq21Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(kdrl:Hsa.PAK1-Hsa.KRAS) ZDB-TGCONSTRCT-180307-2 2019-09-17
ZDB-ALT-180306-9 cq22Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg2(coro1a:Kaede) ZDB-TGCONSTRCT-180306-7 2019-09-17
ZDB-ALT-180306-10 cq23Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(kdrl:pecam1-GFP) ZDB-TGCONSTRCT-180306-8 2019-09-17
ZDB-ALT-171003-10 cq29 Small Deletion embryos treated with CRISPR1-cd93 Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 17 2019-09-17
ZDB-ALT-150922-4 cq2Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg2(fabp10a:mCherry-NTR) ZDB-TGCONSTRCT-150922-3 2019-09-17
ZDB-ALT-170316-3 cq30 Small Deletion embryos treated with CRISPR1-clec14a Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 17 2019-09-17
ZDB-ALT-180521-5 cq31 Point Mutation ENU Lingfei Luo Lab ZDB-LAB-130430-1 Ambiguous 2019-09-17
ZDB-ALT-180521-6 cq32Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg2(fabp2:DsRed) ZDB-TGCONSTRCT-180521-1 2019-09-17
ZDB-ALT-180521-7 cq33Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(hsp70l:urb1-FLAG) ZDB-TGCONSTRCT-180521-2 2019-09-17
ZDB-ALT-180919-6 cq34 Point Mutation ENU Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 14 2019-09-17
ZDB-ALT-180815-1 cq37 Point Mutation Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 3 2019-09-17
ZDB-ALT-170517-8 cq38 Small Deletion embryos treated with CRISPR1-gspt1l Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 3 2019-09-17
ZDB-ALT-150922-5 cq3Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(hsp70l:LOXP-DsRed-LOXP-GFP) ZDB-TGCONSTRCT-150922-4 2019-09-17
ZDB-ALT-190715-5 cq41Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(ddx4:Dendra2-NTR-UTR) ZDB-TGCONSTRCT-190715-2 2019-09-17
ZDB-ALT-180713-2 cq42 Point Mutation ENU Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 13 2019-09-17
ZDB-ALT-180713-1 cq43 Small Deletion embryos treated with CRISPR1-urb2 Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 13 2019-09-17
ZDB-ALT-181108-7 cq44Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(fabp10a:HA-zc3h6-2A-mCherry) ZDB-TGCONSTRCT-181108-2 2019-09-17
ZDB-ALT-181108-5 cq45 Indel embryos treated with TALEN1-zc3h6 Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 13 2019-09-17
ZDB-ALT-181108-6 cq46 Small Deletion embryos treated with TALEN1-zc3h6 Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 13 2019-09-17
ZDB-ALT-180613-1 cq47 Small Deletion embryos treated with TALEN2-irf8 Li Li Lab ZDB-LAB-180601-2 Chr: 18 2019-09-17
ZDB-ALT-180613-2 cq48 Small Deletion embryos treated with TALEN2-irf8 Li Li Lab ZDB-LAB-180601-2 Chr: 18 2019-09-17
ZDB-ALT-180613-3 cq49 Complex embryos treated with CRISPR1-mertka the mutations are predicted to create a premature stop codon Li Li Lab ZDB-LAB-180601-2 Chr: 13 2019-09-17
ZDB-ALT-150922-6 cq4Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(fabp10a:LOXP-STOP-LOXP-DsRed2) ZDB-TGCONSTRCT-150922-5 2019-09-17
ZDB-ALT-151231-1 cq5 Point Mutation ENU Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 13 2019-09-17
ZDB-ALT-180613-4 cq50Tg Transgenic Insertion embryos treated with DNA Li Li Lab ZDB-LAB-180601-2 Unmapped Tg(coro1a:mertka) ZDB-TGCONSTRCT-180613-1 2019-09-17
ZDB-ALT-180702-1 cq52Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(kdrl:Dendra2) ZDB-TGCONSTRCT-180702-1 2019-09-17
ZDB-ALT-190620-11 cq64Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(10xUAS:Cre,cryaa:Venus) ZDB-TGCONSTRCT-190620-5 2019-09-17
ZDB-ALT-190620-12 cq65Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(10xUAS:Kaede,cryaa:Venus) ZDB-TGCONSTRCT-190620-6 2019-09-17
ZDB-ALT-190620-9 cq66Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(fabp10a:LOXP-CFP-NTR-LOXP-DsRed) ZDB-TGCONSTRCT-190620-3 2019-09-17
ZDB-ALT-190620-10 cq67Tg Transgenic Insertion embryos treated with DNA Lingfei Luo Lab ZDB-LAB-130430-1 Unmapped Tg(ins:LOXP-CFP-NTR-LOXP-DsRed) ZDB-TGCONSTRCT-190620-4 2019-09-17
ZDB-ALT-190212-1 cq68 Indel embryos treated with CRISPR1-lars1b Lingfei Luo Lab ZDB-LAB-130430-1 Chr: 21 2019-09-17
ZDB-ALT-190306-12 crg1 Insertion embryos treated with CRISPR2-esrp1 Irimia Lab ZDB-LAB-190123-1 Chr: 16 2019-09-17
ZDB-ALT-190306-13 crg2 Small Deletion embryos treated with CRISPR1-esrp2 Irimia Lab ZDB-LAB-190123-1 Chr: 7 2019-09-17
ZDB-ALT-120405-1 cs10Tg Tg(Bfl.SoxE:GFP)cs10 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg(Bfl.SoxE:EGFP) ZDB-TGCONSTRCT-120405-1 2019-09-17
ZDB-ALT-121231-1 cs11Tg Tg(hsp70l:dkk1b-mCherry)cs11 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg(hsp70l:dkk1b-mCherry) ZDB-TGCONSTRCT-121231-1 2019-09-17
ZDB-ALT-121231-2 cs12Tg Tg(hsp70l.1:bmp2b)cs12 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg1(hsp70l:bmp2b) ZDB-TGCONSTRCT-121231-2 2019-09-17
ZDB-ALT-121231-3 cs13Tg Tg(Tru.Pax3a.1-Mmu.Fos:GFP)cs13 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg1(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-3 2019-09-17
ZDB-ALT-121231-4 cs14Tg Tg(Tru.Pax3a.1-Mmu.Fos:GFP)cs14 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg1(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-3 2019-09-17
ZDB-ALT-121231-5 cs15Tg Tg(Tru.Pax3a.1-Mmu.Fos:GFP)cs15 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg1(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-3 2019-09-17
ZDB-ALT-121231-6 cs16Tg Tg(Tru.Pax3a.1-Mmu.Fos:GFP)cs16 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg1(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-3 2019-09-17
ZDB-ALT-121231-7 cs17Tg Tg(Tru.Pax3a.1-Mmu.Fos:GFP)cs17 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg1(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-3 2019-09-17
ZDB-ALT-121231-8 cs18Tg Tg(Tru.Pax3a.2-Mmu.Fos:GFP)cs18 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg2(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-4 2019-09-17
ZDB-ALT-121231-9 cs19Tg Tg(Tru.Pax3a.2-Mmu.Fos:GFP)cs19 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg2(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-4 2019-09-17
ZDB-ALT-070327-1 cs1Tg Tg(dlx2b:EGFP)cs1, Tg(dlx2b:EGFP)wj1 Transgenic Insertion embryos treated with DNA Stock Lab ZDB-LAB-000207-1 Unmapped Tg(dlx2b:EGFP) ZDB-TGCONSTRCT-070327-1 2019-09-17
ZDB-ALT-121231-10 cs20Tg Tg(Tru.Pax3a.2-Mmu.Fos:GFP)cs20 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg2(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-4 2019-09-17
ZDB-ALT-121231-11 cs21Tg Tg(Tru.Pax3a.3-Mmu.Fos:GFP)cs21 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg3(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-5 2019-09-17
ZDB-ALT-121231-12 cs22Tg Tg(Tru.Pax3a.3-Mmu.Fos:GFP)cs22 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg3(Tru.Pax3a-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-5 2019-09-17
ZDB-ALT-121231-13 cs23Tg Tg(Tru.Zic3.1-Mmu.Fos:GFP)cs23 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg1(Tru.Zic3-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-6 2019-09-17
ZDB-ALT-121231-14 cs24Tg Tg(Tru.Zic3.1-Mmu.Fos:GFP)cs24 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg1(Tru.Zic3-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-6 2019-09-17
ZDB-ALT-121231-15 cs25Tg Tg(Tru.Zic3.2-Mmu.Fos:GFP)cs25 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg2(Tru.Zic3-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-7 2019-09-17
ZDB-ALT-121231-16 cs26Tg Tg(Tru.Zic3.2-Mmu.Fos:GFP)cs26 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg2(Tru.Zic3-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-7 2019-09-17
ZDB-ALT-121231-17 cs27Tg Tg(Tru.Zic3.2-Mmu.Fos:GFP)cs27 Transgenic Insertion embryos treated with DNA Medeiros Lab ZDB-LAB-120405-1 Unmapped Tg2(Tru.Zic3-Mmu.Fos:GFP) ZDB-TGCONSTRCT-121231-7 2019-09-17
ZDB-ALT-171115-1 cs2Tg Transgenic Insertion embryos treated with DNA Stock Lab ZDB-LAB-000207-1 Unmapped Tg(hsp70l:fgf10a-EGFP) ZDB-TGCONSTRCT-171115-1 2019-09-17
ZDB-ALT-140820-6 cs3Tg Transgenic Insertion embryos treated with DNA Stock Lab ZDB-LAB-000207-1 Unmapped Tg(Xla.Eef1a1:eda) ZDB-TGCONSTRCT-140820-3 2019-09-17
ZDB-ALT-050209-54 csf1ra_unspecified un_csf1r, un_csf1ra, un_fms, unspecified_csf1r, unspecified_csf1ra Unspecified Chr: 14 2019-09-17
ZDB-ALT-170118-1 csu6Tg Transgenic Insertion embryos treated with DNA Nissen Lab ZDB-LAB-130823-1 Unmapped Tg(hsp70l:GFP-dcaf7,myl7:EGFP) ZDB-TGCONSTRCT-170118-2 2019-09-17
ZDB-ALT-170118-2 csu9Tg Transgenic Insertion embryos treated with DNA Nissen Lab ZDB-LAB-130823-1 Unmapped Tg(hsp70l:GFP-dcaf7,myl7:EGFP) ZDB-TGCONSTRCT-170118-2 2019-09-17
ZDB-ALT-120213-34 csz1Tg Tg(pomca:pttg1)csz1 Transgenic Insertion embryos treated with DNA Melmed Lab ZDB-LAB-111128-1 Unmapped Tg(pomca:pttg1) ZDB-TGCONSTRCT-120213-2 2019-09-17
ZDB-ALT-120213-35 csz2Tg Tg(pomca:pttg1)csz2 Transgenic Insertion embryos treated with DNA Melmed Lab ZDB-LAB-111128-1 Unmapped Tg(pomca:pttg1) ZDB-TGCONSTRCT-120213-2 2019-09-17
ZDB-ALT-120213-36 csz3Tg Tg(pomca:pttg1)csz3 Transgenic Insertion embryos treated with DNA Melmed Lab ZDB-LAB-111128-1 Unmapped Tg(pomca:pttg1) ZDB-TGCONSTRCT-120213-2 2019-09-17
ZDB-ALT-120209-54 ct103bGt This feature is representative of one or more unknown insertion sites. ct103b, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct103b, Gt(nt5c2a:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Ambiguous Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-51 ct104aGt This feature is representative of one or more unknown insertion sites. ct104a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct104a, Gt(magt1:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 14 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-52 ct110aGt This feature is representative of one or more unknown insertion sites. ct110a, Gt(foxd3-citrine-alg6), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct110a Transgenic Insertion embryos treated with DNA This gene trap line replaces the Foxd3 gene product with a chimeric fusion protein consisting of the N-terminal portion of Foxd3 (lacking the forkhead domain and nuclear localization signal) fused to Citrine and either exon 2, 3 or 9 from the neighboring gene alg6, all under endogenous foxd3 regulatory control. Heterozygotes undergo normal development and are viable. Homozygotes display defects in a variety of neural crest-derived tissues. Scott Fraser Lab ZDB-LAB-000204-2 Chr: 6 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-130314-2 ct110aRGt This feature is representative of one or more unknown insertion sites. ct110aR, Gt(foxd3- mcherry), Gt(FRT-LOXP-mCherry-LOXPV-FRT)ct110aR Transgenic Insertion embryos treated with DNA This gene trap line replaces the Foxd3 gene product with a fusion protein consisting of the N-terminal region of Foxd3 (lacking the forkhead domain and nuclear localization signal) fused to mCherry under endogenous foxd3 regulatory control. Heterozygotes undergo normal development and are viable. Homozygotes display defects in a variety of neural crest-derived tissues. Bronner-Fraser Lab ZDB-LAB-090216-1 Chr: 6 Gt(FRT-LOXP-mCherry-LOX2272-FRT) ZDB-GTCONSTRCT-130314-1 2019-09-17
ZDB-ALT-120209-37 ct110bGt This feature is representative of one or more unknown insertion sites. ct110b, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct110b, Gt(si:ch211-24c14.1:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 16 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120210-9 ct111aGt This feature is representative of one or more unknown insertion sites. ct111aTg, Gt(dnm1l-citrine), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct111a Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 25 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-57 ct116aGt This feature is representative of one or more unknown insertion sites. ct116a, Gt(cltca:citrine), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct116a Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 10 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-22 ct119aGt This feature is representative of one or more unknown insertion sites. ct119a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct119a, Gt(zgc:110063:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 5 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-58 ct122aGt This feature is representative of one or more unknown insertion sites. ct122a, Gt(desma:citrine), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct122a Transgenic Insertion embryos treated with DNA citrine has been inserted between amino acids 460 and 461 in the C terminus of desmin a. Scott Fraser Lab ZDB-LAB-000204-2 Chr: 9 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-170501-5 ct122aRGt This feature is representative of one or more unknown insertion sites. ct122aRGtTg Transgenic Insertion This line was created by Cre-lox recombination of the ct122aGt line.
Upon Cre-lox recombination, the ct122aGt is converted to a mCherry fusion that truncates the Desma protein, leading to a mCherry tag followed by a stop codon in the case of the reverted Ct122aRGt (or ct122aRGt) line, leading to the deletion of 13 C-terminal amino acids in the tail domain. Vermot Lab ZDB-LAB-150617-1 Chr: 9 Gt(FRT-LOXP-mCherry-LOX2272-FRT) ZDB-GTCONSTRCT-130314-1 2019-09-17
ZDB-ALT-120209-23 ct122bGt This feature is representative of one or more unknown insertion sites. ct122b, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct122b, Gt(zgc:65996:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 21 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-38 ct123aGt This feature is representative of one or more unknown insertion sites. ct123a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct123a, Gt(si:ch73-234b20.5:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 10 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-24 ct126bGt This feature is representative of one or more unknown insertion sites. ct126b, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct126b, Gt(zgc:158375:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 25 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-39 ct127aGt This feature is representative of one or more unknown insertion sites. ct127a, Gt(exoc4:citrine), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct127a Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 4 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-111010-22 ct130aGt This feature is representative of one or more unknown insertion sites. ct130a, ct130aTg, Gt(1Citrine-YFP)ct130a Transgenic Insertion embryos treated with DNA Bronner-Fraser Lab ZDB-LAB-090216-1 Chr: 1 Gt1(Citrine) ZDB-GTCONSTRCT-111010-1 2019-09-17
ZDB-ALT-120209-40 ct133aGt This feature is representative of one or more unknown insertion sites. ct133a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct133a, Gt(si:ch211-245g11.2:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 15 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-25 ct140aGt This feature is representative of one or more unknown insertion sites. ct140a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct140a, Gt(zgc:92357:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 4 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-111128-1 ct143aGt This feature is representative of one or more unknown insertion sites. ct143a, Gt(1Citrine-YFP)ct143a Transgenic Insertion embryos treated with DNA Bronner-Fraser Lab ZDB-LAB-090216-1 Ambiguous Gt1(Citrine) ZDB-GTCONSTRCT-111010-1 2019-09-17
ZDB-ALT-120209-41 ct146aGt This feature is representative of one or more unknown insertion sites. ct146a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct146a, Gt(si:dkeyp-55f12.4:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 20 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-26 ct149aGt This feature is representative of one or more unknown insertion sites. ct149a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct149a, Gt(zgc:153607:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 13 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-42 ct151aGt This feature is representative of one or more unknown insertion sites. ct151a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct151a, Gt(rfc1:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Unmapped Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-43 ct158aGt This feature is representative of one or more unknown insertion sites. ct158a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct158a, Gt(si:dkey-263m10.2:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 1 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-44 ct162aGt This feature is representative of one or more unknown insertion sites. ct162a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct162a, Gt(rab3ab:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 11 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-45 ct168aGt This feature is representative of one or more unknown insertion sites. ct168a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct168a, Gt(sobpa:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 13 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120210-8 ct170aGt This feature is representative of one or more unknown insertion sites. Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct170a Transgenic Insertion DNA Scott Fraser Lab ZDB-LAB-000204-2 Unmapped Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-47 ct29aGt This feature is representative of one or more unknown insertion sites. ct29a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct29a, Gt(hmga2:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 4 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-13 ct30aGt This feature is representative of one or more unknown insertion sites. ct30a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct30a, Gt(rbms3:citrine) Transgenic Insertion embryos treated with DNA The Citrine in ct30a is flanked by splice acceptor and donor sites and is incorporated as an artificial exon into the Rbms3 protein. Homozygous ct30a fish are viable, suggesting that Citrine incorporation does not interfere with protein function.
Reference: Jayasena et al. (2012) Scott Fraser Lab ZDB-LAB-000204-2 Chr: 16 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-27 ct30bGt This feature is representative of one or more unknown insertion sites. ct30b, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct30b, Gt(si:dkey-46l15.1:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 6 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-28 ct30cGt This feature is representative of one or more unknown insertion sites. ct30c, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct30c, Gt(si:ch1073-268b21.1:citring) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 8 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-56 ct31aGt This feature is representative of one or more unknown insertion sites. ct31a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct31a, Gt(tpm4a:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 22 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-14 ct33aGt This feature is representative of one or more unknown insertion sites. ct33a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct33a, Gt(ttc27:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 17 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-29 ct39aGt This feature is representative of one or more unknown insertion sites. ct39a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct39a, Gt(znf385c:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 3 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-111010-23 ct3aGt This feature is representative of one or more unknown insertion sites. ct3a, Gt(Citrine-YFP)ct3a, Gt(ctnna-citrine)ct3a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct3a Transgenic Insertion embryos treated with DNA In the Gt(ctnna-citrine)ct3a transgenic line, citrine fluorescent protein has been inserted in-frame to create a functional alpha-catenin fusion protein.
Reference: Choe et al. (2013) Scott Fraser Lab ZDB-LAB-000204-2 Chr: 24 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120213-28 ct3bGt This feature is representative of one or more unknown insertion sites. ct3bTg, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct3b, Gt(tmpoa:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 4 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-170419-2 ct402aTg Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Unmapped Tg(ubb:MA-Cerulean-2A-Hsa.HIST1H2BJ-Tomato) ZDB-TGCONSTRCT-170419-2 2019-09-17
ZDB-ALT-120209-30 ct42aGt This feature is representative of one or more unknown insertion sites. ct42a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct42a, Gt(myh7bb:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 23 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-15 ct47aGt This feature is representative of one or more unknown insertion sites. ct47a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct47a, Gt(ppp2r5d:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 13 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-16 ct49aGt This feature is representative of one or more unknown insertion sites. ct49a, Gt(epb4113b:citrine), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct49a Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 2 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-59 ct5000Tg Tg(actb2:Cerulean-Cre)ct5000 Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Unmapped Tg(actb2:Cerulean-Cre) ZDB-TGCONSTRCT-120209-5 2019-09-17
ZDB-ALT-120209-48 ct50aGt This feature is representative of one or more unknown insertion sites. ct50a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct50a, Gt(ppp1r14bb:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 7 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-31 ct51aGt This feature is representative of one or more unknown insertion sites. ct51a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct51a, Gt(si:rp71-15d4.2:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 8 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-170123-1 ct520aGt This feature is representative of one or more unknown insertion sites. Gt(jup-citrine) Transgenic Insertion embryos treated with DNA The citrine artificial exon is inserted between exons 13-14 of the junction plakoglobin (jup) gene. This results in a Jup-citrine fusion protein with Citrine Cterminal to the armadillo domain. Scott Fraser Lab ZDB-LAB-000204-2 Chr: 11 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-49 ct52bGt This feature is representative of one or more unknown insertion sites. ct52b, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct52b, Gt(mapkapk2a:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 11 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-17 ct56aGt This feature is representative of one or more unknown insertion sites. ct56a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct56a, Gt(zgc:77056:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 16 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-55 ct57aGt This feature is representative of one or more unknown insertion sites. ct57a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct57a, Gt(msi2b:citrine) Transgenic Insertion embryos treated with DNA Hoghgreb-Hagele et al (2014): construct is inserted between exons 6 and 7 of msi2b. Therefore, the fusion protein contains all the endogenous features of Msi2b, including its 5' and 3' UTR. In the gt(msi2b-citrine)ct57a line, endogenous Msi2b is expressed as a fusion protein with Citrine inserted within the intron between exons 6 and 7, without disrupting splice donor (SD) and acceptor sites. Scott Fraser Lab ZDB-LAB-000204-2 Chr: 15 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-18 ct58aGt This feature is representative of one or more unknown insertion sites. ct58a, Gt(dpp9:citrine), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct58a Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 8 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-160309-1 ct5aGt This feature is representative of one or more unknown insertion sites. Gt(tpm3-citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 19 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-19 ct65aGt This feature is representative of one or more unknown insertion sites. ct65a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct65a, Gt(zgc:101562:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 20 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-140327-1 ct68aGt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 19 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-32 ct69aGt This feature is representative of one or more unknown insertion sites. ct69a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct69a, Gt(si:dkey-30j22.2:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 20 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-170322-18 ct700aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(actb2:AVI-Cerulean-Gga.Rangap1) ZDB-TGCONSTRCT-170322-21 2019-09-17
ZDB-ALT-170322-19 ct701aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(actb2:Gga.Rangap1-Cerulean-AVI) ZDB-TGCONSTRCT-170322-22 2019-09-17
ZDB-ALT-170322-17 ct703aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(kdrl:Eco.BirA-Hsa.HRAS-mCherry) ZDB-TGCONSTRCT-170322-7 2019-09-17
ZDB-ALT-170322-15 ct704aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(myl7:Eco.BirA-Hsa.HRAS-mCherry) ZDB-TGCONSTRCT-170322-5 2019-09-17
ZDB-ALT-170322-16 ct705aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(myl7:NLS-Eco.BirA-Hsa.HRAS-mCherry) ZDB-TGCONSTRCT-170322-6 2019-09-17
ZDB-ALT-170322-12 ct706aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(sox10:Eco.BirA-Hsa.HRAS-mCherry) ZDB-TGCONSTRCT-170322-3 2019-09-17
ZDB-ALT-170322-13 ct706bTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(sox10:Eco.BirA-Hsa.HRAS-mCherry) ZDB-TGCONSTRCT-170322-3 2019-09-17
ZDB-ALT-170322-14 ct708aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(zic2a:NLS-Eco.BirA-Hsa.HRAS-mCherry) ZDB-TGCONSTRCT-170322-4 2019-09-17
ZDB-ALT-170322-10 ct709aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(actb2:Eco.BirA-Hsa.HRAS-mCherry) ZDB-TGCONSTRCT-170322-19 2019-09-17
ZDB-ALT-170322-11 ct710aTg Transgenic Insertion embryos treated with DNA Sauka-Spengler Lab ZDB-LAB-140402-1 Unmapped Tg(actb2:NLS-Eco.BirA-Hsa.HRAS-mCherry) ZDB-TGCONSTRCT-170322-20 2019-09-17
ZDB-ALT-120209-20 ct71aGt This feature is representative of one or more unknown insertion sites. ct71a, Gt(fam101b:citrine), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct71a Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 15 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-150501-1 ct74aGt This feature is representative of one or more unknown insertion sites. CT74a-Citrine Transgenic Insertion embryos treated with DNA Bronner-Fraser Lab ZDB-LAB-090216-1 Unmapped Gt1(Citrine) ZDB-GTCONSTRCT-111010-1 2019-09-17
ZDB-ALT-120209-33 ct78bGt This feature is representative of one or more unknown insertion sites. ct78b, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct78b, Gt(si:dkey-6e12.4:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 18 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-130925-5 ct7aGt This feature is representative of one or more unknown insertion sites. Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct7a Transgenic Insertion embryos treated with DNA In this line, an exon encoding the yellow fluorescent protein, citrine, is integrated between exons 3 and 4 of the PKCa gene, resulting in the expression of a PKCa-citrine fusion protein under the control of the endogenous PKCa transcriptional regulatory elements ( References: Trinh et al. (2011) , Palanca et al. (2012)
). Scott Fraser Lab ZDB-LAB-000204-2 Chr: 6 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-131122-2 ct801 Small Deletion embryos treated with TALEN1-aanat2 10bp deletion Prober Lab ZDB-LAB-091123-1 Chr: 3 2019-09-17
ZDB-ALT-131122-3 ct802 Insertion embryos treated with zinc finger nuclease 4bp insertion Prober Lab ZDB-LAB-091123-1 Chr: 8 2019-09-17
ZDB-ALT-131122-4 ct803 Small Deletion embryos treated with zinc finger nuclease 61bp deletion Prober Lab ZDB-LAB-091123-1 Ambiguous 2019-09-17
ZDB-ALT-131122-5 ct804 Indel embryos treated with zinc finger nuclease 5bp insertion Prober Lab ZDB-LAB-091123-1 Chr: 7 2019-09-17
ZDB-ALT-131122-6 ct805 Small Deletion embryos treated with TALEN1-clcf1 19bp deletion Prober Lab ZDB-LAB-091123-1 Chr: 14 2019-09-17
ZDB-ALT-131122-7 ct806 Insertion embryos treated with zinc finger nuclease 4bp insertion; the mutated protein is predicted to be a 178 amino acid peptide lacking the DBH active site, instead of the full length 614 amino acid protein. Prober Lab ZDB-LAB-091123-1 Chr: 10 2019-09-17
ZDB-ALT-131122-8 ct807 Small Deletion embryos treated with TALEN1-fgf21 10bp deletion; Genomic coordinates: (GRCz11) KN149943.1:10963-10972 Prober Lab ZDB-LAB-091123-1 Unmapped 2019-09-17
ZDB-ALT-131125-1 ct808 Indel embryos treated with TALEN1-qrfpra 23bp insertion Prober Lab ZDB-LAB-091123-1 Chr: 13 2019-09-17
ZDB-ALT-131125-2 ct809 Small Deletion embryos treated with zinc finger nuclease 4bp deletion Prober Lab ZDB-LAB-091123-1 Chr: 12 2019-09-17
ZDB-ALT-131122-9 ct810 Small Deletion embryos treated with TALEN1-nmu 4bp deletion (GATG) Prober Lab ZDB-LAB-091123-1 Chr: 20 2019-09-17
ZDB-ALT-131122-10 ct811 Small Deletion embryos treated with zinc finger nuclease The mutant contains a 17 bp deletion (AGCCCGACAACCCGGGA) after nucleotide 94 of the open reading frame of the npy gene, resulting in a translational frameshift beginning at the fourth amino acid of the mature peptide domain. Mutant animals were genotyped using the primers 5'-ATAAATTGCGCATCAGCACA-3' and 5'-TGAGGAAGAATTTGAGACTACGC-3', which produce a 281 or 264 bp band for the WT or mutant allele, respectively. Prober Lab ZDB-LAB-091123-1 Chr: 19 2019-09-17
ZDB-ALT-131122-11 ct812 Small Deletion embryos treated with TALEN1-prok2 1 bp deletion Prober Lab ZDB-LAB-091123-1 Chr: 6 2019-09-17
ZDB-ALT-131122-12 ct813 Small Deletion embryos treated with TALEN1-prokr1a 203bp deletion Prober Lab ZDB-LAB-091123-1 Chr: 1 2019-09-17
ZDB-ALT-131125-3 ct814 Indel embryos treated with TALEN1-prokr1b Prober Lab ZDB-LAB-091123-1 Chr: 13 2019-09-17
ZDB-ALT-131125-4 ct815 Insertion embryos treated with zinc finger nuclease 4bp insertion Prober Lab ZDB-LAB-091123-1 Chr: 19 2019-09-17
ZDB-ALT-131122-13 ct816 Small Deletion embryos treated with TALEN1-tgfa 4bp deletion Prober Lab ZDB-LAB-091123-1 Chr: 6 2019-09-17
ZDB-ALT-131122-14 ct817 Indel embryos treated with zinc finger nuclease 4bp insertion Prober Lab ZDB-LAB-091123-1 Chr: 18 2019-09-17
ZDB-ALT-131122-15 ct818 Small Deletion embryos treated with TALEN1-vip 26bp deletion Prober Lab ZDB-LAB-091123-1 Chr: 13 2019-09-17
ZDB-ALT-150605-1 ct819Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hcrt:RFP) ZDB-TGCONSTRCT-150605-1 2019-09-17
ZDB-ALT-120209-53 ct81Gt This feature is representative of one or more unknown insertion sites. ct81, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct81, Gt(rfx2:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 8 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-150605-2 ct820Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(qrfp:EGFP) ZDB-TGCONSTRCT-150605-2 2019-09-17
ZDB-ALT-150605-3 ct821Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg2(dbh:EGFP) ZDB-TGCONSTRCT-150605-3 2019-09-17
ZDB-ALT-150610-5 ct822Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(aanat2:CFP-NTR) ZDB-TGCONSTRCT-150626-1 2019-09-17
ZDB-ALT-150625-1 ct823 Small Deletion embryos treated with CRISPR1-aanat1 aanat1 mutants were generated using the Cas9/CRISPR method and the sgRNA 5'-GGAGCGTGTGTCGGCGCTGG-3'. The aanat1 mutant contains a 40 bp deletion (nucleotides 67-106 of the open reading frame: 5'- CGCCAGCGCCGACACACGCTCCCAGCAAGCGAGTTTCGCT-3'). This deletion results in a change in reading frame after amino acid 23 and a premature stop codon after amino acid 78, compared to 204 amino acids for the WT protein. - Gandhi et al. (2015) Neuron 85(6): 1193-9 (ZDB-PUB-150311-4) Prober Lab ZDB-LAB-091123-1 Chr: 6 2019-09-17
ZDB-ALT-150721-5 ct824Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hcrt:Rno.Trpv1-TagRFP) ZDB-TGCONSTRCT-150721-5 2019-09-17
ZDB-ALT-150721-6 ct825Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(isl1:GAL4VP16,4xUAS:Rno.Trpv1-TagRFP) ZDB-TGCONSTRCT-150721-6 2019-09-17
ZDB-ALT-150721-7 ct826Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(isl1:GAL4-VP16,4xUAS:Cat.TRPA1-TagRFP) ZDB-TGCONSTRCT-160421-1 2019-09-17
ZDB-ALT-151228-1 ct827 Indel embryos treated with zinc finger nuclease 11 bp insertion (GTTTCGCTAGC)
ZFN binding sites: CACACCGAC and GATGTGGAG Prober Lab ZDB-LAB-091123-1 Chr: 22 2019-09-17
ZDB-ALT-151228-2 ct828 Small Deletion embryos treated with zinc finger nuclease 5 bp deletion (AAGAA)
ZFIN binding sites: TGCTCCACC and GAAGAATGT Prober Lab ZDB-LAB-091123-1 Chr: 2 2019-09-17
ZDB-ALT-151230-6 ct829 nmur2 mutant Small Deletion embryos treated with TALEN1-nmur3 17 bp deletion (TTTAGCCTGGCCATCTC) Prober Lab ZDB-LAB-091123-1 Chr: 11 2019-09-17
ZDB-ALT-120209-21 ct82aGt This feature is representative of one or more unknown insertion sites. ct82a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct82a, Gt(zgc:153362:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 11 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-151230-8 ct830Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:nmu) ZDB-TGCONSTRCT-151230-3 2019-09-17
ZDB-ALT-160122-8 ct831Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hcrt:Cr.Chr2_H134R-EYFP) ZDB-TGCONSTRCT-160122-7 2019-09-17
ZDB-ALT-160407-1 ct833Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(qrfp:LOX2272-LOXP-Tomato-LOX2272-Cerulean-LOXP-EYFP) ZDB-TGCONSTRCT-160407-2 2019-09-17
ZDB-ALT-160407-2 ct834Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:qrfp) ZDB-TGCONSTRCT-160407-1 2019-09-17
ZDB-ALT-160415-1 ct835 Small Deletion embryos treated with TALEN2-qrfpra This is a mutant with a 11 bp deletion in the qrfpra gene which introduces a shift in the reading frame before the first TM domain resulting in premature stop codon and a 105 aa protein. Prober Lab ZDB-LAB-091123-1 Chr: 13 2019-09-17
ZDB-ALT-170509-2 ct836 Small Deletion embryos treated with TALEN1-hdc Prober Lab ZDB-LAB-091123-1 Chr: 18 2019-09-17
ZDB-ALT-170509-3 ct837 Small Deletion embryos treated with TALEN1-hrh2a Prober Lab ZDB-LAB-091123-1 Chr: 14 2019-09-17
ZDB-ALT-170509-4 ct838 Small Deletion embryos treated with TALEN1-hrh2b Prober Lab ZDB-LAB-091123-1 Chr: 10 2019-09-17
ZDB-ALT-170509-5 ct839 Small Deletion embryos treated with zinc finger nuclease Prober Lab ZDB-LAB-091123-1 Chr: 7 2019-09-17
ZDB-ALT-120209-50 ct83aGt This feature is representative of one or more unknown insertion sites. ct83a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct83a, Gt(sf3a3:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Chr: 19 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-170509-6 ct840Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hcrt:ReaChR-Citrine) ZDB-TGCONSTRCT-170509-1 2019-09-17
ZDB-ALT-170522-10 ct841Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:prok2) ZDB-TGCONSTRCT-170522-1 2019-09-17
ZDB-ALT-170522-11 ct842 Small Deletion embryos treated with TALEN1-prok2 Mutant contains an 8 bp deletion (nucleotides 124-131 of the open reading frame: 5’-TGTGGATC -3’), which results in a change in reading frame after amino acid 41 and a premature stop codon after amino acid 87 compared to 107 amino acids for the WT protein. Mutants were genotyped using the primers 5’-CAAGTGGACACACCGAACAC-3’ and 5’-ATCCTGGAATGGAAATGGTG-3’. PCR products were digested with BamHI. Mutant (404 bp) and WT (155 bp + 257 bp) bands were distinguished by running the digested PCR product on a 2% agarose gel.; The predicted mutant protein lacks key conserved domains including 5 of 10 cysteine residues and the dibasic proteolytic cleavage site, and is thus likely non-functional Prober Lab ZDB-LAB-091123-1 Chr: 6 2019-09-17
ZDB-ALT-170522-12 ct843 Indel embryos treated with TALEN1-prokr1a Mutant contains a 7 bp deletion (nucleotides 411-422 of the open reading frame: 5’-TACGTGTCCAC-3’ was replaced by 5’-TTGGT3’), which results in a change in reading frame after amino acid 136 and a premature stop codon after amino acid 156 compared to 385 amino acids for the WT protein. Mutants were genotyped using the primers 5’-GGCGTTGGTAATTGCGTATT-3’ and 5’-TATCAGCCACCAGCACTCTG-3’. PCR products were digested with AflIII. Mutant (527 bp) and WT (218 bp + 316 bp) bands were distinguished by running the digested PCR reaction on a 2% agarose gel.; predicted mutant protein lacks more than 4 transmembrane domains and is thus likely non-functional Prober Lab ZDB-LAB-091123-1 Unmapped 2019-09-17
ZDB-ALT-170522-13 ct844 Small Deletion embryos treated with TALEN1-prokr1b Mutant contains a 1 bp deletion (nucleotide 12 of the open reading frame: 5’-C-3’), which results in a change in reading frame after amino acid 4 and a premature stop codon after amino acid 13 compared to 396 amino acids for the WT protein. Mutants were genotyped using the primers 5’-TGAGCGTAATGCTAATGGTCT-3’ and 5’-CCAGAGTGGCGATAAACACA-3’. PCR products were digested with BsaHI. Mutant (428 bp) and WT (190 bp + 239 bp) bands were distinguished by running the digested PCR reaction on a 2% agarose gel.; predicted mutant protein lacks all 7 transmembrane domains and is thus likely non-functional Prober Lab ZDB-LAB-091123-1 Chr: 13 2019-09-17
ZDB-ALT-170927-1 ct845 Small Deletion embryos treated with CRISPR1-npvf In humans and zebrafish, npvf encodes a preproprotein that contains three mature peptides: RFRP1, RFRP2 and RFRP3. The ct845 mutant contains a 7 bp deletion (CCCAAGT) after nucleotide 324 of the open reading frame of npvf. The mutation results in a change in translational reading frame after amino acid 108 and a premature stop codon after amino acid 146, compared to 198 amino acids for the WT protein. The predicted mutant protein contains RFRP1 but lacks the RFRP2 and RFRP3 peptide sequences. Prober Lab ZDB-LAB-091123-1 Chr: 19 2019-09-17
ZDB-ALT-170927-2 ct846Tg Transgenic Insertion Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:npvf) ZDB-TGCONSTRCT-170927-1 2019-09-17
ZDB-ALT-170927-3 ct847Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(npvf:EGFP) ZDB-TGCONSTRCT-170927-2 2019-09-17
ZDB-ALT-170927-4 ct848Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(npvf:KALTA4) ZDB-TGCONSTRCT-170927-3 2019-09-17
ZDB-ALT-170927-5 ct849Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(npvf:ReaChR-mCitrine) ZDB-TGCONSTRCT-170927-4 2019-09-17
ZDB-ALT-170927-6 ct850Tg Transgenic Insertion Prober Lab ZDB-LAB-091123-1 Unmapped Tg(npvf:mTagYFP-T2A-eNTR) ZDB-TGCONSTRCT-170927-5 2019-09-17
ZDB-ALT-170927-7 ct851Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(10xUAS:Rno.Trpv1-TagRFP,myl7:EGFP) ZDB-TGCONSTRCT-170927-6 2019-09-17
ZDB-ALT-170927-8 ct852Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(npy:KALTA4) ZDB-TGCONSTRCT-170927-7 2019-09-17
ZDB-ALT-171002-3 ct853Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:npy) ZDB-TGCONSTRCT-171002-2 2019-09-17
ZDB-ALT-171004-1 ct854Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:npvf-RFRP1) ZDB-TGCONSTRCT-171004-1 2019-09-17
ZDB-ALT-171004-2 ct855Tg ct85Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:npvf-RFRP2) ZDB-TGCONSTRCT-171004-2 2019-09-17
ZDB-ALT-171004-3 ct856Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:npvf-RFRP3) ZDB-TGCONSTRCT-171004-3 2019-09-17
ZDB-ALT-171004-4 ct857Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:npvf-RFRP1,2) ZDB-TGCONSTRCT-171004-4 2019-09-17
ZDB-ALT-171004-5 ct858Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:npvf-RFRP1,3) ZDB-TGCONSTRCT-171004-5 2019-09-17
ZDB-ALT-171004-6 ct859Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:npvf-RFRP2,3) ZDB-TGCONSTRCT-171004-6 2019-09-17
ZDB-ALT-171004-7 ct860Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:RFRPscr) ZDB-TGCONSTRCT-171004-7 2019-09-17
ZDB-ALT-171009-1 ct861 Small Deletion embryos treated with CRISPR1-crha Prober Lab ZDB-LAB-091123-1 Chr: 2 2019-09-17
ZDB-ALT-171009-2 ct862 Insertion embryos treated with CRISPR1-crhb Prober Lab ZDB-LAB-091123-1 Chr: 24 2019-09-17
ZDB-ALT-180501-6 ct863Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(hsp70l:Cel.flp-13) ZDB-TGCONSTRCT-180501-6 2019-09-17
ZDB-ALT-190508-1 ct864Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(tph2:EGFP) ZDB-TGCONSTRCT-190508-1 2019-09-17
ZDB-ALT-190508-2 ct865Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(tph2:ChR2-YFP) ZDB-TGCONSTRCT-190508-2 2019-09-17
ZDB-ALT-190508-3 ct866Tg Transgenic Insertion embryos treated with DNA Prober Lab ZDB-LAB-091123-1 Unmapped Tg(tph2:eNTR-YFP) ZDB-TGCONSTRCT-190508-3 2019-09-17
ZDB-ALT-190607-1 ct867 Small Deletion embryos treated with CRISPR Prober Lab ZDB-LAB-091123-1 Unmapped 2019-09-17
ZDB-ALT-190725-1 ct868 Small Deletion Prober Lab ZDB-LAB-091123-1 Unmapped 2019-09-17
ZDB-ALT-190725-2 ct869 Indel Prober Lab ZDB-LAB-091123-1 Unmapped 2019-09-17
ZDB-ALT-190725-3 ct870 Indel Prober Lab ZDB-LAB-091123-1 Unmapped 2019-09-17
ZDB-ALT-190725-4 ct871Tg Transgenic Insertion Prober Lab ZDB-LAB-091123-1 Unmapped 2019-09-17
ZDB-ALT-190725-5 ct872Tg Transgenic Insertion Prober Lab ZDB-LAB-091123-1 Unmapped 2019-09-17
ZDB-ALT-120209-46 ct90aGt This feature is representative of one or more unknown insertion sites. ct90a, Gt(dmd:citrine), Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct90a Transgenic Insertion embryos treated with DNA Ruf-Zamojski et al (2015): vector inserted between exons 4 and 5 of the dystrophin (dmd) locus. Protein domain prediction suggests that the gene trap creates a fusion protein with Citrine between the two CH domains in the Nterminal calponin homology domain of Dmd. Scott Fraser Lab ZDB-LAB-000204-2 Chr: 1 Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-34 ct96aGt This feature is representative of one or more unknown insertion sites. ct96a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct96a Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Unmapped Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-35 ct98aGt This feature is representative of one or more unknown insertion sites. ct98a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct98a Transgenic Insertion adult males treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Unmapped Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-36 ct99aGt This feature is representative of one or more unknown insertion sites. ct99a, Gt(FRT-LOXP-Citrine-LOXPV-mCherry-LOXP-LOXPV-FRT)ct99a, Gt(si:ch211-146l10.2:citrine) Transgenic Insertion embryos treated with DNA Scott Fraser Lab ZDB-LAB-000204-2 Ambiguous Gt(FRT-LOXP-Citrine-LOX2272-mCherry-LOXP-LOX2272-FRT) ZDB-GTCONSTRCT-120209-1 2019-09-17
ZDB-ALT-090408-1 ctd_unspecified un_ctd, unspecified_ctd Unspecified This record has been created in support of data for which a publication has not specified an allele. Unmapped 2019-09-17
ZDB-ALT-050209-40 ctnnb2_unspecified ich_unspecified, un_ich, unspecified_ich Unspecified Chr: 19 2019-09-17
ZDB-ALT-170616-4 cu10Tg Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(UAS:Dendra2-Hsa.MAPT_A152T,myl7:EGFP) ZDB-TGCONSTRCT-170616-4 2019-09-17
ZDB-ALT-170616-5 cu11Tg Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg3(Xla.Eef1a1:GAL4-VP16) ZDB-TGCONSTRCT-170616-5 2019-09-17
ZDB-ALT-190304-2 cu12Tg Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(rho:EGFP-Hsa.MAPT_P301L) ZDB-TGCONSTRCT-190304-2 2019-09-17
ZDB-ALT-190719-3 cu13Tg Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(UAS:atg5,myl7:EGFP) ZDB-TGCONSTRCT-190719-2 2019-09-17
ZDB-ALT-190719-4 cu14Tg Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(UAS:FLAG-atg4b_C74A,myl7:EGFP) ZDB-TGCONSTRCT-190719-3 2019-09-17
ZDB-ALT-190719-5 cu15Tg Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(UAS:His-bcl2l11_L128E_F135E,myl7:EGFP) ZDB-TGCONSTRCT-190719-4 2019-09-17
ZDB-ALT-190719-6 cu16Tg Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(ubb:ERT2-GAL4-VP16,cryaa:RFP) ZDB-TGCONSTRCT-130822-3 2019-09-17
ZDB-ALT-070129-1 cu1Tg ath5:gap-gfp, Tg(atoh7:gap43-GFP)cu1 Transgenic Insertion embryos treated with DNA Harris Lab ZDB-LAB-070129-2 Unmapped Tg(atoh7:GAP-GFP) ZDB-TGCONSTRCT-070129-1 2019-09-17
ZDB-ALT-070129-2 cu2Tg Tg(atoh7:gap43-RFP)cu2, Tg(pBatoh7:gap43-rfp); ath5:gap-rfp Transgenic Insertion embryos treated with DNA Harris Lab ZDB-LAB-070129-2 Unmapped Tg(atoh7:GAP-RFP) ZDB-TGCONSTRCT-070129-2 2019-09-17
ZDB-ALT-170404-12 cu3313Tg Transgenic Insertion embryos treated with DNA Harris Lab ZDB-LAB-070129-2 Unmapped Tg(gfap:Eco.GltL-cpEGFP) ZDB-TGCONSTRCT-170404-8 2019-09-17
ZDB-ALT-101103-1 cu3Tg Tg(rho:EGFP)2cu3 Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg2(rho:EGFP) ZDB-TGCONSTRCT-101103-1 2019-09-17
ZDB-ALT-081028-1 cu4Tg EGFP-HDQ23, Tg(rho:EGFP-HTTQ23)cu4, Tg(rho:EGFP-HTTQ23)zf107, zf107 Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(rho:EGFP-HTTQ23) ZDB-TGCONSTRCT-081028-1 2019-09-17
ZDB-ALT-081028-2 cu5Tg EGFP-HDQ71, Tg(rho:EGFP-HTTQ71)cu5, Tg(rho:EGFP-HTTQ71)zf108, zf108 Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(rho:EGFP-HTTQ71) ZDB-TGCONSTRCT-081028-2 2019-09-17
ZDB-ALT-110523-3 cu6Tg Tg(-5bactin2:cetn2-GFP)cu6, Tg(centrin-GFP) Transgenic Insertion embryos treated with DNA Harris Lab ZDB-LAB-070129-2 Unmapped Tg(-5actb2:cetn4-GFP) ZDB-TGCONSTRCT-110523-3 2019-09-17
ZDB-ALT-121206-4 cu7Tg Tg(rho:EGFPtau)cu7 Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(rho:EGFP-Hsa.MAPT) ZDB-TGCONSTRCT-121206-2 2019-09-17
ZDB-ALT-170215-1 cu8Tg Transgenic Insertion embryos treated with DNA Harris Lab ZDB-LAB-070129-2 Unmapped Tg(atoh7:rpl10a-GFP) ZDB-TGCONSTRCT-170215-1 2019-09-17
ZDB-ALT-170616-3 cu9Tg Transgenic Insertion embryos treated with DNA Fleming Lab ZDB-LAB-101027-4 Unmapped Tg(UAS:Dendra2-Hsa.MAPT,myl7:EGFP) ZDB-TGCONSTRCT-170616-3 2019-09-17
ZDB-ALT-050908-4 cw1 Unknown adult males treated with ENU Whitlock Lab ZDB-LAB-001120-1 Unmapped 2019-09-17
ZDB-ALT-190530-2 cwr10 Indel embryos treated with CRISPR1-tmc2a McDermott Lab ZDB-LAB-070315-1 Chr: 5 2019-09-17
ZDB-ALT-161101-2 cwr1001 cwr1 Small Deletion embryos treated with zinc finger nuclease Alagramam Lab ZDB-LAB-161014-2 Chr: 15 2019-09-17
ZDB-ALT-161101-3 cwr1002 cwr2 Small Deletion embryos treated with zinc finger nuclease Alagramam Lab ZDB-LAB-161014-2 Chr: 15 2019-09-17
ZDB-ALT-161101-4 cwr1003 cwr3 Small Deletion embryos treated with zinc finger nuclease Alagramam Lab ZDB-LAB-161014-2 Chr: 15 2019-09-17
ZDB-ALT-161101-5 cwr1004 cwr4 Small Deletion embryos treated with zinc finger nuclease Alagramam Lab ZDB-LAB-161014-2 Chr: 15 2019-09-17
ZDB-ALT-161017-3 cwr1005Tg Transgenic Insertion embryos treated with DNA Alagramam Lab ZDB-LAB-161014-2 Unmapped Tg(pvalb9:Hsa.CLRN1-YFP) ZDB-TGCONSTRCT-161017-1 2019-09-17
ZDB-ALT-161017-4 cwr1006Tg Transgenic Insertion embryos treated with DNA Alagramam Lab ZDB-LAB-161014-2 Unmapped Tg(pvalb9:Hsa.CLRN1_c.144T>G-YFP) ZDB-TGCONSTRCT-161017-2 2019-09-17
ZDB-ALT-140402-2 cwr1Tg Transgenic Insertion embryos treated with DNA McDermott Lab ZDB-LAB-070315-1 Unmapped Tg(pvalb9:actb2-mCherry) ZDB-TGCONSTRCT-140402-3 2019-09-17
ZDB-ALT-150617-1 cwr2Tg Transgenic Insertion embryos treated with DNA McDermott Lab ZDB-LAB-070315-1 Unmapped Tg(pvalb8:ctbp2a-mCherry) ZDB-TGCONSTRCT-150617-1 2019-09-17
ZDB-ALT-160719-8 cwr3Tg Transgenic Insertion embryos treated with DNA McDermott Lab ZDB-LAB-070315-1 Unmapped Tg(pvalb9:EGFP-fscn2b) ZDB-TGCONSTRCT-160719-3 2019-09-17
ZDB-ALT-160719-9 cwr4Tg Transgenic Insertion embryos treated with DNA McDermott Lab ZDB-LAB-070315-1 Unmapped Tg(pvalb9:EGFP-fscn2b_S38A) ZDB-TGCONSTRCT-160719-4 2019-09-17
ZDB-ALT-160719-10 cwr5Tg Transgenic Insertion embryos treated with DNA McDermott Lab ZDB-LAB-070315-1 Unmapped Tg(pvalb9:EGFP-fscn2b_S38E) ZDB-TGCONSTRCT-160719-5 2019-09-17
ZDB-ALT-181128-6 cwr6Tg Transgenic Insertion embryos treated with DNA McDermott Lab ZDB-LAB-070315-1 Unmapped Tg(pvalb9:mCherry) ZDB-TGCONSTRCT-181128-2 2019-09-17
ZDB-ALT-181128-7 cwr7Tg Transgenic Insertion embryos treated with DNA McDermott Lab ZDB-LAB-070315-1 Unmapped Tg(pvalb9:ctbp2a-mCherry) ZDB-TGCONSTRCT-181128-3 2019-09-17
ZDB-ALT-190530-1 cwr8 Small Deletion embryos treated with TALEN1-tmc2b McDermott Lab ZDB-LAB-070315-1 Chr: 5 2019-09-17
ZDB-ALT-190530-3 cwr9 Small Deletion embryos treated with CRISPR1-tmc2b McDermott Lab ZDB-LAB-070315-1 Chr: 5 2019-09-17
ZDB-ALT-091027-10 cx43_unrecovered un_cx43, unrec_connexin43, unrec_cx43, unrecovered_cx43 Point Mutation adult males treated with ENU Chr: 20 2019-09-17
ZDB-ALT-130228-4 cy10Tg Tg(her4.1:h2afva-mCherry)cy10 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(her4.1:h2az2a-mCherry) ZDB-TGCONSTRCT-130228-4 2019-09-17
ZDB-ALT-130228-5 cy11Tg Tg(her4.1:Eco.NfsB-KikGR)cy11 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(her4.1:NTR-KikGR) ZDB-TGCONSTRCT-130228-5 2019-09-17
ZDB-ALT-130228-6 cy12Tg Tg(actb2:Hsa.PYCR1)cy12 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(actb2:Hsa.PYCR1) ZDB-TGCONSTRCT-130228-6 2019-09-17
ZDB-ALT-131011-1 cy13Tg Tg(myl7:h2afva-mCherry,myl7:EGFP)cy13 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(myl7:h2az2a-mCherry,myl7:EGFP) ZDB-TGCONSTRCT-131011-1 2019-09-17
ZDB-ALT-100409-1 cy17Tg Tg(krt4:Eco.NsfB-KikGR)cy17, Tg(krt4:NTR::hKiKGR), Tg(krt4:NTR-hKikGR)cy17, Tg(krt4:NTR-KikGR)cy17 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt4:Eco.NfsB-KikGR) ZDB-TGCONSTRCT-100409-1 2019-09-17
ZDB-ALT-121005-1 cy18Tg Tg(krt4:MYR-Hsa-AKT1)cy18, Tg(krt4:MYR-Hsa.AKT1)cy18, Tg(krt4:MYR-Hsa.AKT1,myl7:EGFP)cy18 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Chr: 22 Tg(krt4:MYR-Hsa.AKT1,IRES:EGFP,myl7:EGFP) ZDB-TGCONSTRCT-121005-1 2019-09-17
ZDB-ALT-110725-1 cy1Tg Tg(bactin2:mCherry,myl7:EGFP)cy1 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(actb2:mCherry,myl7:EGFP) ZDB-TGCONSTRCT-110725-1 2019-09-17
ZDB-ALT-141113-9 cy21Tg Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt4:Mmu.Myc_T>A58,myl7:EGFP) ZDB-TGCONSTRCT-141113-5 2019-09-17
ZDB-ALT-190821-9 cy22Tg Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt4:NLS-EGFP) ZDB-TGCONSTRCT-100409-2 2019-09-17
ZDB-ALT-141113-10 cy24Tg Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt4:Hsa.CDC6,myl7:EGFP) ZDB-TGCONSTRCT-141113-6 2019-09-17
ZDB-ALT-170113-18 cy25Tg Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(Ola.Sp7:nlsGFP) ZDB-TGCONSTRCT-170113-8 2019-09-17
ZDB-ALT-130228-7 cy26Tg Tg(her4.1:jupa-EGFP)cy26 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(her4.1:jupa-EGFP) ZDB-TGCONSTRCT-130228-7 2019-09-17
ZDB-ALT-130228-8 cy29Tg Tg(krt5:h2afva-mCherry)cy29 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt5:h2az2a-mCherry) ZDB-TGCONSTRCT-130228-8 2019-09-17
ZDB-ALT-130228-9 cy30Tg Tg(myl7:Eco.NfsB-KikGR)cy30 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(myl7:Eco.NfsB-KikGR) ZDB-TGCONSTRCT-130228-9 2019-09-17
ZDB-ALT-130228-10 cy31Tg Tg(Ola.Sp7:notch1a)cy31 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(Ola.Sp7:notch1a) ZDB-TGCONSTRCT-130228-10 2019-09-17
ZDB-ALT-130228-11 cy32Tg Tg(Ola.Sp7:bmpr1aa)cy32 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(Ola.Sp7:bmpr1aa) ZDB-TGCONSTRCT-130228-11 2019-09-17
ZDB-ALT-130228-12 cy33Tg Tg(Ola.Sp7:dnbmpr1aa)cy33 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(Ola.Sp7:dnbmpr1aa) ZDB-TGCONSTRCT-130228-12 2019-09-17
ZDB-ALT-100409-2 cy34Tg Tg(krt4:nlsEGFP)cy34 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt4:NLS-EGFP) ZDB-TGCONSTRCT-100409-2 2019-09-17
ZDB-ALT-130228-13 cy35Tg Tg(col2a1a:mib_M1013R)cy35 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(col2a1a:mib_M1013R) ZDB-TGCONSTRCT-130228-13 2019-09-17
ZDB-ALT-130228-14 cy36Tg Tg(col2a1a:bmpr1aa)cy36 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(col2a1a:bmpr1aa) ZDB-TGCONSTRCT-130228-14 2019-09-17
ZDB-ALT-120328-5 cy38Tg Tg(krt4:HPV16.E6)cy38 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt4:HPV16.E6) ZDB-TGCONSTRCT-120328-2 2019-09-17
ZDB-ALT-190514-1 cy50 Small Deletion embryos treated with TALEN2-lepa mutated lepa protein is truncated with only two beta-sheet and one alpha-helix motifs at the C-terminus Epidermal Stem Cell Lab ZDB-LAB-100401-1 Chr: 18 2019-09-17
ZDB-ALT-120328-4 cy6Tg Tg(krt4:Mmu.Stat3)cy6 Transgenic Insertion embryos treated with DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt4:Mmu.Stat3) ZDB-TGCONSTRCT-120328-1 2019-09-17
ZDB-ALT-141126-1 cy9Tg Transgenic Insertion DNA Epidermal Stem Cell Lab ZDB-LAB-100401-1 Unmapped Tg(krt4:h2az2a-mCherry) ZDB-TGCONSTRCT-141126-1 2019-09-17
ZDB-ALT-001127-8 cz11 Insertion adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Chr: 5 2019-09-17
ZDB-ALT-070117-22 cz114 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-060330-24 cz163 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-110124-1 cz1701Tg Tg(-3.5ubb:loxP-EGFP-loxP-mCherry)cz1701, ubi:Switch Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-3.5ubb:LOXP-EGFP-LOXP-mCherry) ZDB-TGCONSTRCT-110124-1 2019-09-17
ZDB-ALT-110121-1 cz1702Tg Tg(-3.5ubb:CreERT2, myl7:EGFP)cz1702, Tg(-3.5ubi:creERT2;cmlc2-EGFP)V, ubi:creERt2 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-3.5ubb:Cre-ERT2,myl7:EGFP) ZDB-TGCONSTRCT-110121-1 2019-09-17
ZDB-ALT-110317-1 cz1703Tg Tg(-3.5ubb:EGFP)cz1703 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-3.5ubb:EGFP) ZDB-TGCONSTRCT-110317-1 2019-09-17
ZDB-ALT-110317-2 cz1704Tg Tg(-3.5ubb:EGFP)cz1704 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-3.5ubb:EGFP) ZDB-TGCONSTRCT-110317-1 2019-09-17
ZDB-ALT-110317-3 cz1705Tg Tg(-3.5ubb:mCherry)cz1705 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-3.5ubb:mCherry) ZDB-TGCONSTRCT-110317-2 2019-09-17
ZDB-ALT-110317-4 cz1706Tg Tg(-3.5ubb:mCherry)cz1706 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-3.5ubb:mCherry) ZDB-TGCONSTRCT-110317-2 2019-09-17
ZDB-ALT-001127-14 cz18 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-060929-10 cz198 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-040723-6 cz1Tg cz1, Tg(lck:lck-GFP), Tg(lck:lck-GFP)cz1 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(lck:lck-EGFP) ZDB-TGCONSTRCT-070117-48 2019-09-17
ZDB-ALT-001127-2 cz20 Unknown The Zon Lab ZDB-LAB-971016-2 Chr: 18 2019-09-17
ZDB-ALT-150512-1 cz2009Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(Mmu.Runx1:EGFP) ZDB-TGCONSTRCT-150512-1 2019-09-17
ZDB-ALT-070117-23 cz201 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-150512-2 cz2010Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(Mmu.Runx1:NLS-mCherry) ZDB-TGCONSTRCT-150512-2 2019-09-17
ZDB-ALT-070117-2 cz206 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-040128-12 cz213 Point Mutation adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-090203-1 cz22 Unknown adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-040213-10 cz226 Point Mutation adult males treated with ENU T-to-G mutation in splice donor site after exon 13 leads to aberrant splicing. Use of downstream cryptic splice donor site results in frameshift and replacement of last 42-aa of protein with a novel 38-aa sequence. The Zon Lab ZDB-LAB-971016-2 Chr: 11 2019-09-17
ZDB-ALT-070117-3 cz237 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-040213-8 cz280 Point Mutation adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Chr: 6 2019-09-17
ZDB-ALT-060330-26 cz289 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-070117-13 cz299 Point Mutation ENU Has a C-to-T mutation at nt 1834 of the coding sequence, which results in a UAG stop codon. Amino acid change Gln612 to Stop The Zon Lab ZDB-LAB-971016-2 Chr: 22 2019-09-17
ZDB-ALT-040723-4 cz2Tg cz2, Tg(lck:lck-EGFP)_unspecified, Tg(lck:lck-GFP), Tg(lck:lck-GFP)cz2, zf529Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(lck:lck-EGFP) ZDB-TGCONSTRCT-070117-48 2019-09-17
ZDB-ALT-001127-12 cz3 Insertion adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Chr: 5 2019-09-17
ZDB-ALT-040128-10 cz319 Point Mutation adult males treated with ENU Verduzco et al. (2012) found C to T mutation at codon 206 which is predicted to result in a premature stop codon and a truncated protein. The Zon Lab ZDB-LAB-971016-2 Chr: 13 2019-09-17
ZDB-ALT-001127-4 cz32 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-070117-24 cz329 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-040128-4 cz3321 Unknown adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-040128-6 cz3322 Point Mutation adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-070725-2 cz3323Tg 25A, Tg(bactin:loxP-EGFP-loxP-Hsa.KRAS_G12D)cz3323, Tg(bactin:loxP-EGFP-loxP-kRASG12D)cz3323, Tg(bactin:loxP-EGFP-loxP-Kras_G12D)cz3323 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(actb2:LOXP-EGFP-LOXP-Hsa.KRAS_G12D) ZDB-TGCONSTRCT-070725-2 2019-09-17
ZDB-ALT-070725-3 cz3324Tg 48, Tg(bactin:loxP-EGFP-loxP-Hsa.KRAS_G12D)cz3324, Tg(bactin:loxP-EGFP-loxP-kRASG12D)cz3324, Tg(bactin:loxP-EGFP-loxP-Kras_G12D)cz3324 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(actb2:LOXP-EGFP-LOXP-Hsa.KRAS_G12D) ZDB-TGCONSTRCT-070725-2 2019-09-17
ZDB-ALT-130522-5 cz3325Tg Tg(LCR:EGFP)cz3325, Tg(LCR:EGFP)zf380, zf380 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(LCR:EGFP) ZDB-TGCONSTRCT-130522-2 2019-09-17
ZDB-ALT-130923-1 cz3326Tg Tg(cdh15:GFP)cz3326 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(cdh15:GFP) ZDB-TGCONSTRCT-130828-2 2019-09-17
ZDB-ALT-130923-2 cz3327Tg Tg(mylpfa:mCherry)cz3327 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(mylpfa:mCherry) ZDB-TGCONSTRCT-130828-3 2019-09-17
ZDB-ALT-150619-1 cz3328Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(hsp70l:angptl2b), Tg(myl7:DsRed2) ZDB-TGCONSTRCT-150619-1, ZDB-TGCONSTRCT-150619-2 2019-09-17
ZDB-ALT-151014-1 cz3329Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(hsp70l:runx1) ZDB-TGCONSTRCT-151014-1 2019-09-17
ZDB-ALT-040128-8 cz333 Point Mutation adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-160106-1 cz3330Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(kdrl:dnHsa.JUNB,GFP) ZDB-TGCONSTRCT-160106-1 2019-09-17
ZDB-ALT-160129-2 cz3331Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-6.35drl:EGFP) ZDB-TGCONSTRCT-160129-1 2019-09-17
ZDB-ALT-160129-3 cz3332Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-6.35drl:Cre-ERT2,myl7:EGFP) ZDB-TGCONSTRCT-160129-2 2019-09-17
ZDB-ALT-160129-4 cz3333Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-6.35drl:Cre-ERT2,cryaa:Venus) ZDB-TGCONSTRCT-160623-1 2019-09-17
ZDB-ALT-160208-1 cz3334Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(crestin:EGFP) ZDB-TGCONSTRCT-160208-1 2019-09-17
ZDB-ALT-160208-2 cz3335Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-4.5-crestin:mCherry) ZDB-TGCONSTRCT-160208-3 2019-09-17
ZDB-ALT-160208-3 cz3336Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg2(crestin:EGFP) ZDB-TGCONSTRCT-160208-2 2019-09-17
ZDB-ALT-160208-4 cz3337Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-4.5-crestin:EGFP) ZDB-TGCONSTRCT-160208-6 2019-09-17
ZDB-ALT-160208-5 cz3338Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(crestin:Cre-ERT2,cryaa:YFP) ZDB-TGCONSTRCT-160208-5 2019-09-17
ZDB-ALT-180306-3 cz3339Tg Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(kdrl:cxcr1,myl7:EGFP) ZDB-TGCONSTRCT-180306-1 2019-09-17
ZDB-ALT-070117-4 cz346 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-000913-2 cz35 z1 Insertion Contains a 1848 bp insertion. Heisenberg Lab ZDB-LAB-010328-1 Ambiguous 2019-09-17
ZDB-ALT-070117-25 cz376 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-070117-5 cz384 Unknown The Zon Lab ZDB-LAB-971016-2 Unmapped 2019-09-17
ZDB-ALT-090714-1 cz4 can4 Point Mutation adult males treated with ENU T-to-A point mutation in intron 14 results in a cryptic splice site, leading to frameshift and premature stop. The Zon Lab ZDB-LAB-971016-2 Ambiguous 2019-09-17
ZDB-ALT-101021-1 cz400 sunrise, sunshine Point Mutation adult males treated with ENU C->T transition at 1507 in cdc73 coding region leading to a premature stop codon The Zon Lab ZDB-LAB-971016-2 Chr: 2 2019-09-17
ZDB-ALT-101021-2 cz401Tg TgBAC(trim33:trim33;-2.7actb1:EGFP)cz401, TgBAC(trim33:trim33;-2.7bactin1:EGFP)cz401, Tif1g+;bactin:GFP Transgenic Insertion DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(-2.7actb1:EGFP), TgBAC(trim33:trim33) ZDB-TGCONSTRCT-140429-4, ZDB-TGCONSTRCT-101021-1 2019-09-17
ZDB-ALT-001127-10 cz5 Insertion adult males treated with ENU The Zon Lab ZDB-LAB-971016-2 Chr: 5 2019-09-17
ZDB-ALT-060602-4 cz61 Point Mutation adult males treated with ENU The T>A mutation at nucleotide 80 of the 91 bp intron 26 creates a cryptic splice acceptor site and leads to an 11 bp insertion in exon 27 of the coding sequence. This leads to the insertion of Phe-Phe-Ser-STOP in the predicted protein. The Zon Lab ZDB-LAB-971016-2 Chr: 2 2019-09-17
ZDB-ALT-070117-6 cz65 Point Mutation adult males treated with ENU Has a G-to-A mutation at nt 820 of the coding sequence, which results in a UGA stop codon. Amino acid change Trp273 to Stop. The Zon Lab ZDB-LAB-971016-2 Chr: 22 2019-09-17
ZDB-ALT-050419-2 czt13Tg czt13, Tg(mitfa:BRAF-V600E), Tg(mitfa:BRAF-V600E)czt13 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(mitfa:Hsa.BRAF_V600E) ZDB-TGCONSTRCT-070117-106 2019-09-17
ZDB-ALT-050419-4 cztq7Tg cztq7, Tg(mitfa:BRAF-V600E), Tg(mitfa:BRAF-V600E)cztq7 Transgenic Insertion embryos treated with DNA The Zon Lab ZDB-LAB-971016-2 Unmapped Tg(mitfa:Hsa.BRAF_V600E) ZDB-TGCONSTRCT-070117-106 2019-09-17
ZDB-ALT-980203-375 da10 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-990423-27 da15 night blindness b Point Mutation ENU There is a substitution of nucleotide G to an A at the beginning of intron 8-9. This mutation altered the donor splice site and resulted in the insertion of a 37 bp fragment which includes a stop codon. Dowling Lab ZDB-LAB-970501-1 Chr: 22 2019-09-17
ZDB-ALT-030828-4 da54 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-030828-2 da56 Unknown adult males treated with ENU Dowling Lab ZDB-LAB-970501-1 Unmapped 2019-09-17
ZDB-ALT-091027-11 dab1a_unrecovered un_dab1, unrec_dab1, unrec_dab1a, unrecovered_dab1a Point Mutation adult males treated with ENU Chr: 20 2019-09-17
ZDB-ALT-060811-4 db1092 b1092 Point Mutation G to A transition in the h3f3a gene; D123N substitution near the C-terminus of the core domain Crump Lab ZDB-LAB-060809-1 Chr: 3 2019-09-17
ZDB-ALT-980203-388 db230 Db230 Unknown adult males treated with ENU Weston Lab ZDB-LAB-970408-87 Chr: 15 2019-09-17
ZDB-ALT-011017-2 dc124 Point Mutation adult males treated with ENU Mutation in col1a1a resulting in a change from Glycine to Aspartate at position 736, interrupting the Gly-X-Y domains of typical collagens. This change prevents the correct formation of the triple helix. Fisher Lab ZDB-LAB-000411-2 Chr: 3 2019-09-17
ZDB-ALT-091027-12 dchs1b_unrecovered dchs1_unrecovered, un_dchs1, unrec_dchs1, unrecovered_dchs1 Point Mutation adult males treated with ENU Chr: 10 2019-09-17
ZDB-ALT-030929-2 dfr3 Point Mutation adult males treated with ENU Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 14 2019-09-17
ZDB-ALT-040412-2 dg2 Unknown adult males treated with ENU Cahill Lab ZDB-LAB-971216-4 Chr: 7 2019-09-17
ZDB-ALT-081009-2 dg3 P36 Point Mutation adult males treated with ENU Cahill Lab ZDB-LAB-971216-4 Chr: 20 2019-09-17
ZDB-ALT-111010-3 dgcr8_unrecovered Point Mutation adult males treated with ENU Chr: 5 2019-09-17
ZDB-ALT-190220-2 dgi4 Small Deletion Transplantation Immunology ZDB-LAB-190220-1 Unmapped 2019-09-17
ZDB-ALT-040217-4 dhi2058Tg This feature is representative of one or more unknown insertion sites. hi2058, hi2058Tg, hiD2058 Transgenic Insertion DNA Insertion at the splice donor of the first exon. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040217-6 dhi4000Tg This feature is representative of one or more unknown insertion sites. hi4000, hi4000Tg, hiD4000 Transgenic Insertion DNA Could have been created with either the F5 or GT virus (more likely GT, but cannot be sure). Insertion site in the fifth intron. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(F5), Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-174, ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120403-1 dhi862Tg This feature is representative of one or more unknown insertion sites. hiD862 Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Unmapped Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-010427-4 dhiD1Tg This feature is representative of one or more unknown insertion sites. hiD1, hiD1Tg Transgenic Insertion DNA Insertion site in the fifth intron. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(SFG) ZDB-TGCONSTRCT-070117-176 2019-09-17
ZDB-ALT-010427-2 dhiD2Tg This feature is representative of one or more unknown insertion sites. hiD2, hiD2Tg Transgenic Insertion DNA Insertion site in the fifth intron. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(SFG) ZDB-TGCONSTRCT-070117-176 2019-09-17
ZDB-ALT-170630-4 dhkz1a Small Deletion embryos treated with CRISPR1-tpcn2 Laboratory of Dr. Andrew L. Miller ZDB-LAB-970424-45 Chr: 7 2019-09-17
ZDB-ALT-180425-2 dhu11202 Small Deletion embryos treated with CRISPR2-vclb This line is maintained by the Huveneer Lab ZDB-LAB-180424-2 Hubrecht Institute ZDB-LAB-141201-1 Chr: 12 2019-09-17
ZDB-ALT-130118-1 dhu423 Point Mutation hu423 has a T to A substitution at position 2087 of myh6 cDNA. This substitution changes an asparagine to a lysine at codon 695 located within the myosin head at the base of the myosin head. This allele is dominant and viable. myh6 hu423/+ mutant carriers are adult viable, exhibiting a partial loss of atrial contractility. ( Singleman et al. ZDB-PUB-121030-7 ) Rob Wilkinson ZDB-LAB-040708-1 Chr: 20 2019-09-17
ZDB-ALT-120222-2 dia9 Unknown spontaneous A semi-dominant maternal effect allele affecting laterality. Argenton Lab ZDB-LAB-990226-9 Unmapped 2019-09-17
ZDB-ALT-091027-13 disc1_unrecovered un_disc1, unrec_disc1, unrecovered_disc1 Point Mutation adult males treated with ENU Chr: 13 2019-09-17
ZDB-ALT-050209-24 disp1_unspecified un_con, un_disp1, unspecified_disp1 Unspecified Chr: 20 2019-09-17
ZDB-ALT-181205-1 djh503 Small Deletion embryos treated with CRISPR14-rho The allele contains a 5 bp deletion in the 3' coding sequence of the gene (c.(964_968delTGCTG)). This frameshift is predicted to alter a post-translationally palmitoylated cysteine at position 322 to an arginine (p.(Cys322Argfs*116)) and create an elongated protein that terminates at aa 437 rather than at aa 357.; The CRISPRs CRISPR15-rho and CRISPR16-rho were also injected to create this line. However, the only detected mutation appeared to be the result of CRISPR14-rho. Mumm Lab ZDB-LAB-090729-1 Chr: 8 2019-09-17
ZDB-ALT-050930-4 dk3a k3a Unknown ENU Segregation is Mendelian, but semi-dominant. Takahashi Lab ZDB-LAB-980521-2 Unmapped 2019-09-17
ZDB-ALT-050930-2 dk8f k8f Unknown ENU Segregation is Mendelian, but semi-dominant. Takahashi Lab ZDB-LAB-980521-2 Unmapped 2019-09-17
ZDB-ALT-050126-6 dl01 Unknown adult males treated with ENU A dominant mutation isolated from the F1 generation of ENU mutagenized fish. Lei Li Lab ZDB-LAB-000330-1 Unmapped 2019-09-17
ZDB-ALT-050126-8 dl02 Unknown adult males treated with ENU A dominant mutation isolated from the F1 generation of ENU mutagenized fish. Lei Li Lab ZDB-LAB-000330-1 Unmapped 2019-09-17
ZDB-ALT-050126-10 dl03 Unknown adult males treated with ENU A dominant mutation isolated from the F1 generation of ENU mutagenized fish. Lei Li Lab ZDB-LAB-000330-1 Unmapped 2019-09-17
ZDB-ALT-050209-16 dlc_unspecified un_bea, un_dlc, unspecified_dlc Unspecified Chr: 15 2019-09-17
ZDB-ALT-050209-8 dld_unspecified un_aei, un_dld, unspecified_dld Unspecified Chr: 13 2019-09-17
ZDB-ALT-180320-1 dmh1 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 15 2019-09-17
ZDB-ALT-180320-2 dmh11 Unknown adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Unmapped 2019-09-17
ZDB-ALT-180319-16 dmh13 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 3 2019-09-17
ZDB-ALT-180319-15 dmh14 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 3 2019-09-17
ZDB-ALT-180319-18 dmh15 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 19 2019-09-17
ZDB-ALT-180319-23 dmh16 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 12 2019-09-17
ZDB-ALT-180319-33 dmh18 Unknown adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Unmapped 2019-09-17
ZDB-ALT-180319-32 dmh19 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 8 2019-09-17
ZDB-ALT-180319-27 dmh20 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 20 2019-09-17
ZDB-ALT-180319-21 dmh21 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 8 2019-09-17
ZDB-ALT-180319-34 dmh22 Unknown adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Unmapped 2019-09-17
ZDB-ALT-180319-19 dmh27 Point Mutation adult females treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 8 2019-09-17
ZDB-ALT-180319-20 dmh28 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 8 2019-09-17
ZDB-ALT-180319-17 dmh29 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 12 2019-09-17
ZDB-ALT-180319-31 dmh3 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 9 2019-09-17
ZDB-ALT-180320-4 dmh30 Point Mutation Matthew Harris Lab ZDB-LAB-100714-1 Chr: 8 2019-09-17
ZDB-ALT-180319-24 dmh31 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 5 2019-09-17
ZDB-ALT-180319-28 dmh32 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 20 2019-09-17
ZDB-ALT-180319-29 dmh33 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 20 2019-09-17
ZDB-ALT-180319-30 dmh34 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 20 2019-09-17
ZDB-ALT-180319-26 dmh35 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 20 2019-09-17
ZDB-ALT-180319-25 dmh4 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Unmapped 2019-09-17
ZDB-ALT-180319-36 dmh7 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 1 2019-09-17
ZDB-ALT-180319-35 dmh8 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 1 2019-09-17
ZDB-ALT-180319-37 dmh9 Point Mutation adult males treated with ENU Matthew Harris Lab ZDB-LAB-100714-1 Chr: 15 2019-09-17
ZDB-ALT-090910-3 dne3256 Unknown adult males treated with ENU Bally-Cuif Lab ZDB-LAB-990226-15 Unmapped 2019-09-17
ZDB-ALT-090408-2 doc_unspecified un_doc, unspecified_doc Unspecified This record has been created in support of data for which a publication has not specified an allele. Unmapped 2019-09-17
ZDB-ALT-160216-1 dp14nba dp14nb Unknown adult males treated with ENU Mullins Laboratory ZDB-LAB-990119-1 Unmapped 2019-09-17
ZDB-ALT-040224-14 dp15mf Unknown adult males treated with ENU Mullins Laboratory ZDB-LAB-990119-1 Chr: 20 2019-09-17
ZDB-ALT-180117-3 dp197 bias, biased, p197 Unknown adult males treated with ENU Michael Granato Lab ZDB-LAB-970618-1 Unmapped 2019-09-17
ZDB-ALT-090323-1 dt1248 dt3Tpl, topless Point Mutation adult males treated with ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 9 2019-09-17
ZDB-ALT-090324-1 dt1261 dt3S243X, nackt Point Mutation adult males treated with ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 5 2019-09-17
ZDB-ALT-980203-340 dt2 Dt2 Unknown Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 2 2019-09-17
ZDB-ALT-150923-2 dt30mh dmht30, t30mh Point Mutation ENU This allele of the kcnk5b gene has a mutation changing a G to a T resulting in a missense mutation W169L in the protein. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 20 2019-09-17
ZDB-ALT-150312-8 dt3oj022 Point Mutation adult males treated with ENU This is a dominant mutation that results in a V85M change in the protein sequence. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 1 2019-09-17
ZDB-ALT-090309-3 dta5 Point Mutation adult males treated with ENU Semi-dominant allele. A single point mutation (G to T) results in the substitution of Gly598 for a Val (Olson et al. 2010, ZDB-PUB-100614-30). Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 3 2019-09-17
ZDB-ALT-060929-28 dtbe4 tbe4 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 10 2019-09-17
ZDB-ALT-060929-32 dtbe6 tbe6 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 10 2019-09-17
ZDB-ALT-060929-38 dtbi3 tbi3 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 9 2019-09-17
ZDB-ALT-040528-2 dtbn12 dbn12 Point Mutation adult males treated with ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 6 2019-09-17
ZDB-ALT-060929-42 dtbv27 tbv27 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 7 2019-09-17
ZDB-ALT-980203-795 dtc24 Point Mutation adult males treated with ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 14 2019-09-17
ZDB-ALT-060929-46 dtda5 tda5 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 3 2019-09-17
ZDB-ALT-060929-52 dtdc27 tdc27 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 13 2019-09-17
ZDB-ALT-060929-58 dtdi3 tdi3 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 7 2019-09-17
ZDB-ALT-060929-60 dtdl1 tdl1 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 7 2019-09-17
ZDB-ALT-060929-56 dtfa17 tfa17 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 20 2019-09-17
ZDB-ALT-060929-54 dtfa9 tfa9 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 10 2019-09-17
ZDB-ALT-060929-50 dtfs4 tfs4 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 10 2019-09-17
ZDB-ALT-060929-48 dtft1 tft1 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 22 2019-09-17
ZDB-ALT-980203-1618 dti216c Point Mutation adult males treated with ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 14 2019-09-17
ZDB-ALT-150312-7 dtk3 Point Mutation adult males treated with ENU This is a dominant mutation that results in a I152F change in the protein sequence. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 1 2019-09-17
ZDB-ALT-150312-9 dtnr16 Point Mutation adult males treated with ENU This is a dominant mutation that results in a Y66S change in the protein sequence. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 1 2019-09-17
ZDB-ALT-150312-10 dtnz Point Mutation adult males treated with ENU This is a dominant mutation that results in a V79M change in the protein sequence. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 1 2019-09-17
ZDB-ALT-060929-4 dto22 to22 Unknown ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 1 2019-09-17
ZDB-ALT-980203-1558 dtq270 AQ70, tq270 Point Mutation adult males treated with ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 1 2019-09-17
ZDB-ALT-980203-1181 dtv43 hab, half baked Point Mutation adult males treated with ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 7 2019-09-17
ZDB-ALT-150429-4 dtva6 VA6 Point Mutation adult males treated with ENU The C to T transition leads to the exchange of an arginine to a cysteine at amino acid 146. Mutation has a semi-dominant effect. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 7 2019-09-17
ZDB-ALT-980203-1559 dtw28 tw28, W28 Point Mutation adult males treated with ENU Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 1 2019-09-17
ZDB-ALT-160729-5 dtwc3 moonstone Point Mutation embryos treated with ENU change in the kinase domain of the protein, which is highly conserved throughout the tyrosine kinase family Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 17 2019-09-17
ZDB-ALT-150312-11 dtxa9 luc Point Mutation adult males treated with ENU This is a mis-sense mutation in the gene encodingcx39.4. An A to C transversion leads to an\namino acid exchange T29P within the first transmembrane domain. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 19 2019-09-17
ZDB-ALT-150312-12 dtxg1 luc Point Mutation adult males treated with ENU This is a mis-sense mutation in the gene encoding cx39.4. A G to T transversion leads to an amino acid exchange W47L within first extracellular loop. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 19 2019-09-17
ZDB-ALT-980203-1265 dty40 Point Mutation adult males treated with ENU This allele contains an Asp(447)-> Glu exchange caused by a GAT->GAA mutation. This Asp residue is conserved in all members of the Smad family. This mutation has a strong hypomorphic and weak antimorphic effect. Nüsslein-Volhard Lab ZDB-LAB-971209-4 Chr: 14 2019-09-17
ZDB-ALT-021014-2 dx2 Point Mutation adult males treated with ENU Riley Lab ZDB-LAB-970908-94 Chr: 1 2019-09-17
ZDB-ALT-090504-2 dz101 z101 Unknown adult males treated with ENU These dominant mutants have T cell leukemia & lymphoma predisposition. In a WIK background heterozygotes have a 14.1% penetrance and a 6.4 month typical latency while homozygotes have a 43% penetrance and a 4.8 month typical latency. Trede Lab ZDB-LAB-041123-5 Unmapped 2019-09-17
ZDB-ALT-090504-6 dz102 z102 Unknown adult males treated with ENU These dominant mutants have T cell leukemia & lymphoma predisposition. In a WIK background heterozygotes have a 5.9% penetrance and a 8.7 month typical latency while homozygotes have a 40.3% penetrance and a 7.6 month typical latency. Trede Lab ZDB-LAB-041123-5 Unmapped 2019-09-17
ZDB-ALT-110131-49 e100Tg Tg(dharma:GFP)e100 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(dharma:GFP) ZDB-TGCONSTRCT-110131-41 2019-09-17
ZDB-ALT-130516-1 e102Tg Tg(actb2:LMA-Tomato)e102 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(actb2:LY-Tomato) ZDB-TGCONSTRCT-130516-1 2019-09-17
ZDB-ALT-111207-6 e103Tg Tg(actb2:h2afv-mCherry)e103 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(actb2:h2az2a-mCherry) ZDB-TGCONSTRCT-111207-2 2019-09-17
ZDB-ALT-111207-5 e112Tg Tg(krt4:EGFP-CAAX)e112 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(krt4:EGFP-CAAX) ZDB-TGCONSTRCT-111207-1 2019-09-17
ZDB-ALT-130206-1 e114Tg Tg(actb2:LIFEACT-GFP)e114 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(actb2:LIFEACT-GFP) ZDB-TGCONSTRCT-130206-1 2019-09-17
ZDB-ALT-130206-2 e115Tg Tg(actb2:LIFEACT-­RFP)e115 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(actb2:LIFEACT-RFP) ZDB-TGCONSTRCT-130206-2 2019-09-17
ZDB-ALT-130206-3 e116Tg Tg(actb2:GFP-Hsa.UTRN)e116 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(actb2:GFP-Hsa.UTRN) ZDB-TGCONSTRCT-130206-3 2019-09-17
ZDB-ALT-150727-1 e117Tg Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(sebox:EGFP) ZDB-TGCONSTRCT-150727-1 2019-09-17
ZDB-ALT-151029-1 e118Tg Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(sox17:LY-Tomato) ZDB-TGCONSTRCT-151029-1 2019-09-17
ZDB-ALT-151029-2 e119Tg Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(actb2:mCherry-Hsa.UTRN) ZDB-TGCONSTRCT-151029-2 2019-09-17
ZDB-ALT-161005-1 e120Tg Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(gsc:TurboRFP) ZDB-TGCONSTRCT-161005-1 2019-09-17
ZDB-ALT-130108-3 e1954Tg Tg(actb2:myl12.1-mCherry)e1954 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(actb2:myl12.1-mCherry) ZDB-TGCONSTRCT-130108-3 2019-09-17
ZDB-ALT-060214-2 e1Tg e1, Tg(pax2a:GFP), Tg(pax2a:GFP)e1 Transgenic Insertion embryos treated with DNA Brand Lab ZDB-LAB-970909-2 Unmapped Tg(pax2a:GFP) ZDB-TGCONSTRCT-070117-168 2019-09-17
ZDB-ALT-130108-2 e2212Tg Tg(actb2:myl12.1-EGFP)e2212 Transgenic Insertion embryos treated with DNA Heisenberg Lab ZDB-LAB-010328-1 Unmapped Tg(actb2:myl12.1-EGFP) ZDB-TGCONSTRCT-130108-2 2019-09-17
ZDB-ALT-060214-4 e2Tg e2, Tg(pax2a:lacZ), Tg(pax2a:lacZ)e2 Transgenic Insertion embryos treated with DNA Brand Lab ZDB-LAB-970909-2 Unmapped Tg(pax2a:lacZ) ZDB-TGCONSTRCT-070117-53 2019-09-17
ZDB-ALT-100504-1 e3 Point Mutation adult males treated with ENU Brand Lab ZDB-LAB-970909-2 Chr: 9 2019-09-17
ZDB-ALT-100505-11 e30 Point Mutation adult males treated with ENU Brand Lab ZDB-LAB-970909-2 Chr: 6 2019-09-17
ZDB-ALT-100412-3 e36 Point Mutation Brand Lab ZDB-LAB-970909-2 Chr: 16 2019-09-17
ZDB-ALT-100514-19 e37 Point Mutation adult males treated with ENU Brand Lab ZDB-LAB-970909-2 Chr: 7 2019-09-17
ZDB-ALT-100506-11 e44 Point Mutation adult males treated with ENU Brand Lab ZDB-LAB-970909-2 Chr: 3 2019-09-17
ZDB-ALT-181106-6 e46 A > T, ZMP:e46 Point Mutation adult males treated with ENU Brand Lab ZDB-LAB-970909-2 Chr: 11 2019-09-17
ZDB-ALT-100505-7 e47 Point Mutation adult males treated with ENU Brand Lab ZDB-LAB-970909-2 Chr: 11 2019-09-17
ZDB-ALT-100505-6 e48 Point Mutation adult males treated with ENU C115T mutation in cep55,resulting in the mutation of a glutamic acid to a stop codonat residue 39 Brand Lab ZDB-LAB-970909-2 Chr: 12 2019-09-17
ZDB-ALT-110825-2 e52 Point Mutation adult males treated with ENU Mutation: C>A Nonsense. Brand Lab ZDB-LAB-970909-2 Chr: 2 2019-09-17
ZDB-ALT-030812-4 e68 Unknown ENU No amino acid change was found in the coding region of this weak allele. Brand Lab ZDB-LAB-970909-2 Chr: 21 2019-09-17
ZDB-ALT-020625-2 e713 Point Mutation ENU The m216 and e713 alleles show the same base change. Brand Lab ZDB-LAB-970909-2 Chr: 21 2019-09-17
ZDB-ALT-190830-6 ecn1 Small Deletion embryos treated with CRISPR2-cpt1b exon 2 deletion of AGCACCATGTA at 69bp , premature stop codon at amino acid 81aa Zhen-Yu Du Lab ZDB-LAB-170214-6 Chr: 18 2019-09-17
ZDB-ALT-190830-5 ecn2 Small Deletion embryos treated with CRISPR2-cpt1b exon 2 deletion of ATAGC at 78bp , premature stop codon at amino acid 82aa Zhen-Yu Du Lab ZDB-LAB-170214-6 Chr: 18 2019-09-17
ZDB-ALT-190830-4 ecn3 Small Deletion embryos treated with CRISPR1-atg12 This gene is on CHR_ALT_CTG16_1_8 in Ensembl. The deletion starts at position 13854426 and ends at position 13854433 in GRCz11. Details from researcher: exon1 deletion of GATGAACA at 39bp, premature stop codon at amino acid 24aa Zhen-Yu Du Lab ZDB-LAB-170214-6 Unmapped 2019-09-17
ZDB-ALT-150717-2 ecu1 Pgr15 Small Deletion embryos treated with TALEN1-pgr TALEN induced a two nucleotide (GC) deletion which caused a +1 frameshift predicted to generate a trunated peptide lacking amino acids 74-617 with concurrent alteration of amino acids 51-73. Yong Zhu Lab ZDB-LAB-150713-1 Chr: 18 2019-09-17
ZDB-ALT-150717-3 ecu2 Pgr35 Indel embryos treated with TALEN1-pgr TALEN induced a 25 nucleotide deletion (position 142-166) coupled with a three nucleotide (TTT) insertion which caused a +2 frameshift predicted to generate a truncated peptide lacking amino acids 70-617 with concurrent alteration of amino acids 48-69. Yong Zhu Lab ZDB-LAB-150713-1 Chr: 18 2019-09-17
ZDB-ALT-150717-4 ecu3 Pgr2d Small Deletion embryos treated with TALEN2-pgr TALEN induced a 10 nucleotide deletion (position 616-625) which generated a truncation of amino acids 263-617 with concurrent alteration of amino acids 206-263. Yong Zhu Lab ZDB-LAB-150713-1 Chr: 18 2019-09-17
ZDB-ALT-190207-1 ecu4 Indel embryos treated with CRISPR2-pgrmc1 Yong Zhu Lab ZDB-LAB-150713-1 Chr: 21 2019-09-17
ZDB-ALT-171117-1 ecu5 -14 Small Deletion embryos treated with TALEN1-ar Yong Zhu Lab ZDB-LAB-150713-1 Chr: 5 2019-09-17
ZDB-ALT-171117-2 ecu6 -13 Small Deletion embryos treated with TALEN1-ar Yong Zhu Lab ZDB-LAB-150713-1 Chr: 5 2019-09-17
ZDB-ALT-171117-3 ecu7 -11 Small Deletion embryos treated with TALEN1-ar Yong Zhu Lab ZDB-LAB-150713-1 Chr: 5 2019-09-17
ZDB-ALT-070608-1 ed6Tg Tg(met:Gal4,UAS:EGFP)ed6 Transgenic Insertion embryos treated with DNA Peter Currie Lab ZDB-LAB-990210-2 Unmapped Tg(met:GAL4,UAS:EGFP) ZDB-TGCONSTRCT-070608-1 2019-09-17
ZDB-ALT-180108-4 ed7Tg Transgenic Insertion embryos treated with DNA Sieger Lab ZDB-LAB-130612-1 Unmapped Tg(Xla.Tubb:LEXPR) ZDB-TGCONSTRCT-180108-4 2019-09-17
ZDB-ALT-180117-1 ed9 Small Deletion embryos treated with CRISPR1-cdk9 Rossi Lab ZDB-LAB-140613-2 Chr: 21 2019-09-17
ZDB-ALT-091027-14 efnb2a_unrecovered un_efnb2a, unrec_efnb2a, unrecovered_efnb2a Point Mutation adult males treated with ENU Chr: 9 2019-09-17
ZDB-ALT-091027-21 egr2b_unrecovered un_egr2b, unrec_egr2b, unrec_krox20 (egr2b), unrecovered_egr2b Point Mutation adult males treated with ENU Chr: 12 2019-09-17
ZDB-ALT-120220-2 el106Tg Tg(UAS:shha,myl7:EGFP)el106 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:shha,myl7:EGFP) ZDB-TGCONSTRCT-120220-1 2019-09-17
ZDB-ALT-100803-1 el108Tg Tg(UAS:JAG1)el108 Transgenic Insertion embryos treated with DNA JAG1 is from the human gene, Open Biosystems clone 30528888. Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:Hsa.JAG1,myl7:EGFP) ZDB-TGCONSTRCT-100726-2 2019-09-17
ZDB-ALT-120523-6 el10Tg Tg(sox10:DsRed)el10 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(sox10:DsRed) ZDB-TGCONSTRCT-120523-6 2019-09-17
ZDB-ALT-110919-1 el133Tg Tg(tcf21:Gal4-VP16-Bmo.Ecr,UAS:EGFP)el133 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(tcf21:GAL4-VP16-Bmo.Ecr,UAS:EGFP) ZDB-TGCONSTRCT-110919-1 2019-09-17
ZDB-ALT-120220-3 el137Tg Tg(UAS:shha,myl7:EGFP)el137 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:shha,myl7:EGFP) ZDB-TGCONSTRCT-120220-1 2019-09-17
ZDB-ALT-120523-1 el159Tg Tg(sox10:Gal4-VP16,IRES:EGFP)el159 Transgenic Insertion embryos treated with DNA IRES:EGFP was found to be nonfunctional in this line. Crump Lab ZDB-LAB-060809-1 Unmapped Tg(sox10:GAL4-VP16-IRES-EGFP) ZDB-TGCONSTRCT-120523-1 2019-09-17
ZDB-ALT-120523-2 el15Tg Tg(UAS:MA-KillerRed,myl7:EGFP)el15 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:MA-KillerRed,myl7:EGFP) ZDB-TGCONSTRCT-120523-2 2019-09-17
ZDB-ALT-120523-5 el179Tg Tg(UAS:dntwist1b,UAS:mCherry-CAAX,myl7:EGFP)el179 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:dntwist1b,UAS:mCherry-CAAX,myl7:EGFP) ZDB-TGCONSTRCT-120523-5 2019-09-17
ZDB-ALT-130610-9 el190Tg Tg(UAS:dndvl2,cryaa:Cerulean)el190 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:dndvl2,cryaa:Cerulean) ZDB-TGCONSTRCT-130610-8 2019-09-17
ZDB-ALT-150608-4 el225Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:ephb4a_K662R,cryaa:Cerulean) ZDB-TGCONSTRCT-150608-3 2019-09-17
ZDB-ALT-120215-11 el249Tg Tg(UAS:edn1,cryaa:Cerulean)el249 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:edn1,cryaa:Cerulean) ZDB-TGCONSTRCT-120215-6 2019-09-17
ZDB-ALT-130610-10 el262Tg Tg(UAS:rac1_T17N,cryaa:Cerulean)el262 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:rac1_T17N,cryaa:Cerulean) ZDB-TGCONSTRCT-130610-9 2019-09-17
ZDB-ALT-130610-12 el268Tg Tg(UAS:cdc42_T17N,cryaa:Cerulean)el268, TgUAS:cdc42_T17N,cryaa:Cerulean)el268 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:cdc42_T17N,cryaa:Cerulean) ZDB-TGCONSTRCT-130610-11 2019-09-17
ZDB-ALT-120523-4 el28Tg Tg(UAS:dnfgfr1a,myl7:EGFP)el28 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:dnfgfr1a,myl7:EGFP) ZDB-TGCONSTRCT-120523-4 2019-09-17
ZDB-ALT-111102-3 el2Tg Tg(sox10:KikGR)el2 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(sox10:KikGR) ZDB-TGCONSTRCT-111102-3 2019-09-17
ZDB-ALT-130610-4 el303Tg Tg(nkx2.3:EGFP-dvl2)el303 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.3:EGFP-dvl2) ZDB-TGCONSTRCT-130610-3 2019-09-17
ZDB-ALT-130610-5 el304Tg Tg(nkx2.3:alcama-EGFP)el304 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.3:alcama-EGFP) ZDB-TGCONSTRCT-130610-4 2019-09-17
ZDB-ALT-130610-11 el320Tg Tg(UAS:rac1_G12V,cryaa:Cerulean)el320 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:rac1_G12V,cryaa:Cerulean) ZDB-TGCONSTRCT-130610-10 2019-09-17
ZDB-ALT-150608-6 el321Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:cdh1,cryaa:Cerulean) ZDB-TGCONSTRCT-150608-6 2019-09-17
ZDB-ALT-130610-13 el322Tg Tg(UAS:cdc42_G12V,cryaa:Ceruleanel322 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:cdc42_G12V,cryaa:Cerulean) ZDB-TGCONSTRCT-130610-12 2019-09-17
ZDB-ALT-120215-12 el326Tg Tg(UAS:grem2,cryaa:Cerulean)el326 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:grem2,cryaa:Cerulean) ZDB-TGCONSTRCT-120215-7 2019-09-17
ZDB-ALT-190103-6 el360Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(fli1a:GAL4-VP16,myl7:EGFP) ZDB-TGCONSTRCT-190103-3 2019-09-17
ZDB-ALT-160204-4 el361Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(sox10:mCherry-CAAX) ZDB-TGCONSTRCT-160204-4 2019-09-17
ZDB-ALT-160204-3 el375Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(sox10:EGFP-CAAX) ZDB-TGCONSTRCT-160204-7 2019-09-17
ZDB-ALT-120523-9 el377Tg Tg(UAS:KikGR,cryaa:Cerulean)el377 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:KikGR,cryaa:Cerulean) ZDB-TGCONSTRCT-120523-9 2019-09-17
ZDB-ALT-120523-3 el405Tg Tg(UAS:ida2a,cryaa:Cerulean)el405 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:ida2a,cryaa:Cerulean) ZDB-TGCONSTRCT-120523-3 2019-09-17
ZDB-ALT-120523-7 el411Tg Tg(fli1a-hsp70l:EGFP)el411 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(fli1a-hsp70l:EGFP) ZDB-TGCONSTRCT-120523-7 2019-09-17
ZDB-ALT-130610-6 el421Tg Tg(UAS:wnt11r,cryaa:Cerulean)el421 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:wnt11,cryaa:Cerulean) ZDB-TGCONSTRCT-130610-5 2019-09-17
ZDB-ALT-160204-6 el483Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped TgBAC(col2a1a:EGFP) ZDB-TGCONSTRCT-160204-9 2019-09-17
ZDB-ALT-130610-7 el48Tg Tg(UAS:wnt4a,cryaa:Cerulean)el48 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:wnt4,cryaa:Cerulean) ZDB-TGCONSTRCT-130610-6 2019-09-17
ZDB-ALT-170303-4 el491 Insertion embryos treated with TALEN1-prrx1b Crump Lab ZDB-LAB-060809-1 Chr: 20 2019-09-17
ZDB-ALT-141204-3 el493Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.5:tbx1,cryaa:Cerulean) ZDB-TGCONSTRCT-141204-3 2019-09-17
ZDB-ALT-120215-10 el49Tg Tg(UAS:bmp4,myl7:EGFP)el49 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:bmp4,myl7:EGFP) ZDB-TGCONSTRCT-120215-5 2019-09-17
ZDB-ALT-180628-7 el506 Small Deletion embryos treated with TALEN2-nr2f2 Crump Lab ZDB-LAB-060809-1 Chr: 18 2019-09-17
ZDB-ALT-180606-9 el512 Small Deletion embryos treated with TALEN1-nr2f1a Crump Lab ZDB-LAB-060809-1 Chr: 5 2019-09-17
ZDB-ALT-141204-1 el513Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.3:tbx1,myl7:EGFP) ZDB-TGCONSTRCT-141204-1 2019-09-17
ZDB-ALT-170303-5 el515 Indel embryos treated with TALEN1-notch2 Crump Lab ZDB-LAB-060809-1 Chr: 8 2019-09-17
ZDB-ALT-150507-3 el517 Small Deletion embryos treated with TALEN1-notch2 Kim et al (2014): mutant was generated using TALENS targeting exon 4 of the notch2 gene. This allele contains a 104-bp deletion that causes a frameshift and premature stop codon. Crump Lab ZDB-LAB-060809-1 Chr: 8 2019-09-17
ZDB-ALT-171010-6 el520 Small Deletion embryos treated with TALEN1-cdh11 4 bp deletion induces frameshift after aa 104 (of 800). Crump Lab ZDB-LAB-060809-1 Chr: 7 2019-09-17
ZDB-ALT-180628-6 el523 Small Deletion embryos treated with TALEN1-nr2f1b Crump Lab ZDB-LAB-060809-1 Chr: 10 2019-09-17
ZDB-ALT-150608-5 el530Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:pak2a_K299R,cryaa:Cerulean) ZDB-TGCONSTRCT-150608-4 2019-09-17
ZDB-ALT-160325-1 el538 Indel embryos treated with TALEN1-irx7 WT irx7 ...TGCCTGCTGGATATCAATT
el538 irx7 TGCCA - - TGCCTATCAATT Crump Lab ZDB-LAB-060809-1 Chr: 23 2019-09-17
ZDB-ALT-130610-8 el53Tg Tg(UAS:CFP-Eco.NfsB,myl7:EGFP))el53 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:CFP-Eco.NfsB,myl7:EGFP) ZDB-TGCONSTRCT-130610-7 2019-09-17
ZDB-ALT-160325-2 el540 Small Deletion embryos treated with TALEN1-irx7 WT irx7 .....TGCCTGCTGGATATCAATT
el540 irx7 . T - - - - - - - - - - - - - - - - - T Crump Lab ZDB-LAB-060809-1 Chr: 23 2019-09-17
ZDB-ALT-190103-10 el542 Small Deletion embryos treated with TALEN3-foxc1a Crump Lab ZDB-LAB-060809-1 Chr: 2 2019-09-17
ZDB-ALT-190103-11 el543 Small Deletion embryos treated with TALEN3-foxc1a Crump Lab ZDB-LAB-060809-1 Chr: 2 2019-09-17
ZDB-ALT-190304-3 el548 Indel embryos treated with TALEN1-tcf12 Crump Lab ZDB-LAB-060809-1 Chr: 7 2019-09-17
ZDB-ALT-190103-13 el551 Insertion embryos treated with TALEN1-foxd1 Crump Lab ZDB-LAB-060809-1 Chr: 5 2019-09-17
ZDB-ALT-170303-3 el558 Small Deletion embryos treated with TALEN1-prrx1a Crump Lab ZDB-LAB-060809-1 Chr: 2 2019-09-17
ZDB-ALT-160204-7 el559Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped TgBAC(col2a1a:mCherry-NTR) ZDB-TGCONSTRCT-160204-11 2019-09-17
ZDB-ALT-141204-4 el562Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.5:fgf8a-GFP) ZDB-TGCONSTRCT-141204-4 2019-09-17
ZDB-ALT-141204-2 el567Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.5:wnt11,myl7:EGFP) ZDB-TGCONSTRCT-141204-2 2019-09-17
ZDB-ALT-190304-5 el570 Small Deletion embryos treated with TALEN1-twist1b Crump Lab ZDB-LAB-060809-1 Chr: 16 2019-09-17
ZDB-ALT-190304-4 el571 Small Deletion embryos treated with TALEN1-twist1a Crump Lab ZDB-LAB-060809-1 Chr: 19 2019-09-17
ZDB-ALT-160325-3 el574 Small Deletion embryos treated with TALEN1-irx5a WT irx5a ... ACCCGTATGGAGACCCAGC
el574 irx5a . ACC - - - - - - - - - - - - - AGC Crump Lab ZDB-LAB-060809-1 Chr: 7 2019-09-17
ZDB-ALT-190103-14 el575 Small Deletion embryos treated with TALEN1-foxd2 Crump Lab ZDB-LAB-060809-1 Chr: 8 2019-09-17
ZDB-ALT-160325-4 el576 Small Deletion embryos treated with TALEN1-irx5a WT irx5a .... ACCCGTATGGAGACCCAGC
el576 irx5a . ACCCGTATGGA - ACCCAGC Crump Lab ZDB-LAB-060809-1 Chr: 7 2019-09-17
ZDB-ALT-171010-8 el586 Small Deletion embryos treated with TALEN1-emx2 10-bp deletion induces frameshift after aa 74 (of 247). Crump Lab ZDB-LAB-060809-1 Chr: 13 2019-09-17
ZDB-ALT-150608-1 el589Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.3:efnb2a,myl7:EGFP) ZDB-TGCONSTRCT-150608-1 2019-09-17
ZDB-ALT-150608-2 el590Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.3:pak2a-CAAX,myl7:EGFP) ZDB-TGCONSTRCT-150608-2 2019-09-17
ZDB-ALT-171010-14 el593 Small Deletion embryos treated with TALEN1-osr1 7 bp deletion induces frameshift after aa 80 (of 264) Crump Lab ZDB-LAB-060809-1 Chr: 13 2019-09-17
ZDB-ALT-171214-3 el594 Small Deletion embryos treated with TALEN1-prg4b, TALEN2-prg4b Crump Lab ZDB-LAB-060809-1 Chr: 20 2019-09-17
ZDB-ALT-171010-15 el595 Small Deletion embryos treated with TALEN1-osr2 23-bp deletion induces frameshift after aa 57 (of 238). Crump Lab ZDB-LAB-060809-1 Chr: 16 2019-09-17
ZDB-ALT-150608-3 el605Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.3:pak2a) ZDB-TGCONSTRCT-150608-5 2019-09-17
ZDB-ALT-180628-8 el611 Small Deletion embryos treated with TALEN1-nr2f5 Crump Lab ZDB-LAB-060809-1 Chr: 16 2019-09-17
ZDB-ALT-160204-2 el613Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:irx7-2A-EGFP,cryaa:Cerulean) ZDB-TGCONSTRCT-160204-6 2019-09-17
ZDB-ALT-190104-5 el615 Indel embryos treated with CRISPR1-foxl2a Crump Lab ZDB-LAB-060809-1 Chr: 15 2019-09-17
ZDB-ALT-190104-2 el616 Indel embryos treated with CRISPR1-foxf2a Crump Lab ZDB-LAB-060809-1 Chr: 2 2019-09-17
ZDB-ALT-190104-4 el620 Small Deletion embryos treated with CRISPR2-foxc1b Crump Lab ZDB-LAB-060809-1 Chr: 20 2019-09-17
ZDB-ALT-190104-3 el621 Indel embryos treated with CRISPR1-foxf2b Crump Lab ZDB-LAB-060809-1 Chr: 20 2019-09-17
ZDB-ALT-171010-9 el624 Small Deletion embryos treated with CRISPR1-fsta 14-bp deletion induces frameshift after aa 84 (of 322). Crump Lab ZDB-LAB-060809-1 Chr: 5 2019-09-17
ZDB-ALT-171010-11 el633 Small Deletion embryos treated with TALEN1-her6 8-bp deletion induces frameshift after aa 10 (of 270). Crump Lab ZDB-LAB-060809-1 Chr: 6 2019-09-17
ZDB-ALT-171010-12 el639 Small Deletion embryos treated with CRISPR1-mrrf 4-bp deletion induces frameshift after aa 78 (of 257). Crump Lab ZDB-LAB-060809-1 Chr: 10 2019-09-17
ZDB-ALT-180627-4 el647Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(col2a1a:GAL4-VP16) ZDB-TGCONSTRCT-180627-2 2019-09-17
ZDB-ALT-171010-5 el654 Small Deletion embryos treated with CRISPR1-ccn2b 10-bp deletion induces frameshift after aa 52 (of 345). Crump Lab ZDB-LAB-060809-1 Chr: 20 2019-09-17
ZDB-ALT-190104-1 el658 Small Deletion embryos treated with CRISPR1-foxf1 Crump Lab ZDB-LAB-060809-1 Chr: 18 2019-09-17
ZDB-ALT-190108-3 el660 Small Deletion embryos treated with CRISPR1-foxf1 Crump Lab ZDB-LAB-060809-1 Chr: 18 2019-09-17
ZDB-ALT-180627-5 el662Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:nr2f5,cryaa:Cerulean) ZDB-TGCONSTRCT-180627-3 2019-09-17
ZDB-ALT-180627-6 el663Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:nr2f5,cryaa:Cerulean) ZDB-TGCONSTRCT-180627-3 2019-09-17
ZDB-ALT-171010-13 el667 Small Deletion embryos treated with CRISPR1-sfrp2, CRISPR2-sfrp2 161-bp deletion induces frameshift after aa 85 (of 249). Crump Lab ZDB-LAB-060809-1 Chr: 1 2019-09-17
ZDB-ALT-171010-10 el675 Small Deletion embryos treated with CRISPR1-fstb 14-bp deletion induces frameshift after aa 142 (of 344). Crump Lab ZDB-LAB-060809-1 Chr: 10 2019-09-17
ZDB-ALT-171010-4 el679 Small Deletion embryos treated with CRISPR1-cd248a 11-bp deletion induces frameshift after aa 63 (of 719). Crump Lab ZDB-LAB-060809-1 Chr: 7 2019-09-17
ZDB-ALT-171214-2 el687 Small Deletion embryos treated with TALEN1-prg4a, TALEN2-prg4a Crump Lab ZDB-LAB-060809-1 Chr: 2 2019-09-17
ZDB-ALT-190103-7 el688Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:fgf3,myl7:EGFP) ZDB-TGCONSTRCT-190103-4 2019-09-17
ZDB-ALT-171010-7 el689 Small Deletion embryos treated with CRISPR1-ccn2b 4 bp deletion induces frameshift after aa 70 (of 347). Crump Lab ZDB-LAB-060809-1 Chr: 19 2019-09-17
ZDB-ALT-190808-4 el690Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(rr.col2a1a.2-Mmu.E1b:h2az2a-mCherry-2A-EGFP-CAAX) ZDB-TGCONSTRCT-190808-2 2019-09-17
ZDB-ALT-190808-1 el691Tg Transgenic Insertion sperm treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(rr.col2a1a.2-Mmu.E1b:Cre-ERT2,actb2:LOXP-BFP-LOXP-DsRed) ZDB-TGCONSTRCT-190808-1 2019-09-17
ZDB-ALT-190808-6 el695Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(rr.col2a1a.2-Mmu.E1b:h2az2a-mCherry-2A-EGFP-CAAX) ZDB-TGCONSTRCT-190808-2 2019-09-17
ZDB-ALT-190103-8 el700Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:foxc1a,cryaa:Cerulean) ZDB-TGCONSTRCT-190103-5 2019-09-17
ZDB-ALT-190808-3 el712Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(rr.col2a1a.2-Mmu.E1b:Cre-ERT2,actb2:LOXP-BFP-LOXP-DsRed) ZDB-TGCONSTRCT-190808-1 2019-09-17
ZDB-ALT-190808-2 el713Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(rr.col2a1a.2-Mmu.E1b:Cre-ERT2,actb2:LOXP-BFP-LOXP-DsRed) ZDB-TGCONSTRCT-190808-1 2019-09-17
ZDB-ALT-120828-7 el72Tg Tg(her5:mCherry-CAAX)el72 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(her5:mCherry-CAAX) ZDB-TGCONSTRCT-120828-6 2019-09-17
ZDB-ALT-190723-11 el734 Small Deletion embryos treated with CRISPR5-mmp9 Crump Lab ZDB-LAB-060809-1 Chr: 8 2019-09-17
ZDB-ALT-171115-699 el746Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(myl7:Mmu.Tnni3k-NLS-GFP) ZDB-TGCONSTRCT-171115-5 2019-09-17
ZDB-ALT-171115-700 el747Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(myl7:NLS-GFP) ZDB-TGCONSTRCT-171115-4 2019-09-17
ZDB-ALT-130610-3 el74Tg Tg(nkx2.5:Gal4-VP16,myl7:EGFP)el74 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.5:GAL4-VP16,myl7:EGFP) ZDB-TGCONSTRCT-130610-2 2019-09-17
ZDB-ALT-190103-9 el751Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(UAS:foxf1,cryaa:Cerulean) ZDB-TGCONSTRCT-190103-6 2019-09-17
ZDB-ALT-190723-12 el777Tg Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(sox10:Cre-ERT2,actb2:LOXP-BFP-LOXP-DsRed) ZDB-TGCONSTRCT-190723-11 2019-09-17
ZDB-ALT-120828-8 el83Tg Tg(nkx2.5:EGFP)el83 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.5:EGFP) ZDB-TGCONSTRCT-120828-5 2019-09-17
ZDB-ALT-120523-8 el8Tg Tg(sox10:LOXP-GFP-LOXP-Hsa.DLX3)el8 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(sox10:LOXP-GFP-LOXP-Hsa.DLX3) ZDB-TGCONSTRCT-120523-8 2019-09-17
ZDB-ALT-130610-2 el93Tg Tg(nkx2.3:Gal4-VP16,myl7:EGFP)el93 Transgenic Insertion embryos treated with DNA Crump Lab ZDB-LAB-060809-1 Unmapped Tg(nkx2.3:GAL4-VP16,myl7:EGFP) ZDB-TGCONSTRCT-130610-1 2019-09-17
ZDB-ALT-030617-2 em1 Small Deletion spontaneous A two-base deletion produces a frameshift in codon 41 and results in a truncated protein of 158 amino acids. (Solomon et al., 2003) Fritz Lab ZDB-LAB-000522-1 Chr: 12 2019-09-17
ZDB-ALT-150305-1 em2Tg Transgenic Insertion embryos treated with DNA Shepherd Lab ZDB-LAB-011010-4 Unmapped Tg(-8.3phox2bb:Kaede) ZDB-TGCONSTRCT-150305-1 2019-09-17
ZDB-ALT-131122-1 ens100Tg Tg(elavl3:GCaMP)ens100 Transgenic Insertion embryos treated with DNA SUMBRE Lab ZDB-LAB-100302-1 Unmapped Tg(elavl3:GCaMP3) ZDB-TGCONSTRCT-131122-1 2019-09-17
ZDB-ALT-161209-6 ens101Tg GS10 Transgenic Insertion embryos treated with DNA SUMBRE Lab ZDB-LAB-100302-1 Unmapped Tg(6xUAS:GCaMP3) ZDB-TGCONSTRCT-161209-6 2019-09-17
ZDB-ALT-161209-7 ens102Tg GS16 Transgenic Insertion embryos treated with DNA SUMBRE Lab ZDB-LAB-100302-1 Unmapped Tg(elavl3:GCaMP5) ZDB-TGCONSTRCT-161209-7 2019-09-17
ZDB-ALT-110818-3 ens1Tg Tg(Gga.Egr2-gata2a:EGFP)ens1 Transgenic Insertion embryos treated with DNA Charnay Lab ZDB-LAB-110503-1 Unmapped Tg(Gga.Egr2-gata2a:EGFP) ZDB-TGCONSTRCT-110818-3 2019-09-17
ZDB-ALT-110818-4 ens2Tg Tg(egr2b-gata2a:EGFP)ens2 Transgenic Insertion embryos treated with DNA Charnay Lab ZDB-LAB-110503-1 Unmapped Tg(egr2b-gata2a:EGFP) ZDB-TGCONSTRCT-110818-4 2019-09-17
ZDB-ALT-120316-1 ens3Tg Tg(-5etv5b:Gal4-VP16)ens3 Transgenic Insertion embryos treated with DNA Charnay Lab ZDB-LAB-110503-1 Unmapped Tg(-5etv5b:GAL4-VP16) ZDB-TGCONSTRCT-120316-1 2019-09-17
ZDB-ALT-131211-1 ens4Tg Tg(hsp70l:Mmu.Egr2-HA)ens4 Transgenic Insertion embryos treated with DNA Charnay Lab ZDB-LAB-110503-1 Unmapped Tg(hsp70l:Mmu.Egr2-HA) ZDB-TGCONSTRCT-131211-1 2019-09-17
ZDB-ALT-161209-4 ens700Tg Transgenic Insertion embryos treated with DNA Kapsimali Lab ZDB-LAB-161209-1 Unmapped Tg(tph1b:mCherry,myl7:EGFP) ZDB-TGCONSTRCT-161209-4 2019-09-17
ZDB-ALT-091027-15 eomesa_unrecovered un_eomesa, unrec_eomesa, unrecovered_eomesa Point Mutation adult males treated with ENU Chr: 19 2019-09-17
ZDB-ALT-050819-12 epb41b_unspecified epb41_unspecified, un_epb41, un_mot, unspecified_epb41 Unspecified Chr: 16 2019-09-17
ZDB-ALT-050822-2 epb41l5_unspecified un_epb41l5, un_moe, unspecified_epb41l5 Unspecified Chr: 9 2019-09-17
ZDB-ALT-070406-1 er1Tg Tg(kop:EGFP-UTRnanos3)er1, Tg(kop:EGFP-UTRnanos)er1, Tol2-kop-egfp-farnesylnos1- 3UTR, Tol-kop-EGFP-F-nos1-3UTR Transgenic Insertion DNA Raz Lab ZDB-LAB-980505-1 Unmapped Tg(kop:EGFP-FTASE-UTR-nanos3) ZDB-TGCONSTRCT-070406-1 2019-09-17
ZDB-ALT-080827-2 erbb3b_unspecified un_erbb3b, unspecified_erbb3b Unspecified This record has been created in support of data for which a publication has not specified an allele. Chr: 23 2019-09-17
ZDB-ALT-050211-2 etl1_unspecified un_etl1, unspecified_etl1 Unspecified embryos treated with DNA Unmapped 2019-09-17
ZDB-ALT-050211-8 etl4_unspecified un_etl4, unspecified_etl4 Unspecified embryos treated with DNA Unmapped 2019-09-17
ZDB-ALT-050211-10 etl5_unspecified un_etl5, unspecified_etl5 Unspecified embryos treated with DNA Unmapped 2019-09-17
ZDB-ALT-050211-12 etl6_unspecified un_etl6, unspecified_etl6 Unspecified embryos treated with DNA Unmapped 2019-09-17
ZDB-ALT-050211-14 etl7_unspecified un_etl7, unspecified_etl7 Unspecified embryos treated with DNA Unmapped 2019-09-17
ZDB-ALT-050211-16 etl8_unspecified un_etl8, unspecified_etl8 Unspecified embryos treated with DNA Unmapped 2019-09-17
ZDB-ALT-050211-18 etl9_unspecified un_etl9, unspecified_etl9 Unspecified embryos treated with DNA Unmapped 2019-09-17
ZDB-ALT-050209-12 eya1_unspecified un_aal, un_eya1, unspecified_eya1 Unspecified Chr: 24 2019-09-17
ZDB-ALT-090520-7 f10 Small Deletion embryos treated with zinc finger nuclease This mutation is a 5 bp deletion induced by treatment with a custom zinc finger nuclease. Peterson Lab ZDB-LAB-970909-44 Chr: 19 2019-09-17
ZDB-ALT-160317-7 f102k Point Mutation adult males treated with ENU The splice donor site at intron 9 in the f102k allele was abolished by a T-to-A transition, which led to the retention of intron 9 in the mutant transcript. Intron 9 contains 7 stop codons in all 3 frames. The Fishman Laboratory ZDB-LAB-970409-90 Chr: 10 2019-09-17
ZDB-ALT-090520-8 f11 Insertion embryos treated with zinc finger nuclease This mutation is a 5 bp insertion induced by treatment with a custom zinc finger nuclease. Peterson Lab ZDB-LAB-970909-44 Chr: 20 2019-09-17
ZDB-ALT-110603-3 f12Tg Tg(UAS:secHsa.ANXA5-YFP,myl7:RFP)f12 Transgenic Insertion embryos treated with DNA Randall Peterson Lab ZDB-LAB-030925-2 Unmapped Tg(UAS:SEC-Hsa.ANXA5-YFP,myl7:RFP) ZDB-TGCONSTRCT-110603-2 2019-09-17
ZDB-ALT-151014-3 f136jy Small Deletion embryos treated with CRISPR1-gsk3ba Hwang et al (2013): gsk3b GGGACCTGACCGGCC----------AGCTAC 10-bp deletion Yeh Lab ZDB-LAB-100305-1 Chr: 9 2019-09-17
ZDB-ALT-151014-2 f137jy Insertion embryos treated with CRISPR1-gsk3ba Hwang et al (2013): gsk3b GGGACCTGACC(TGACC)GGCCGCAGG 5-bp insertion Yeh Lab ZDB-LAB-100305-1 Chr: 9 2019-09-17
ZDB-ALT-110328-4 f13Tg Tg(tbp:Gal4)f13 Transgenic Insertion embryos treated with DNA Randall Peterson Lab ZDB-LAB-030925-2 Unmapped Tg(tbp:GAL4,myl7:Cerulean) ZDB-TGCONSTRCT-180327-2 2019-09-17
ZDB-ALT-110808-1 f14Tg Tg(UAS:Hsa.IL6)f14 Transgenic Insertion embryos treated with DNA Randall Peterson Lab ZDB-LAB-030925-2 Unmapped Tg(UAS:Hsa.IL6) ZDB-TGCONSTRCT-110808-1 2019-09-17
ZDB-ALT-110808-2 f15Tg Tg(myl7:Gal4-VP16)f15 Transgenic Insertion embryos treated with DNA Randall Peterson Lab ZDB-LAB-030925-2 Unmapped Tg(myl7:GAL4-VP16) ZDB-TGCONSTRCT-110808-2 2019-09-17
ZDB-ALT-151201-4 f16 Insertion embryos treated with TALEN2-ptpmt1 Nath at al (2015) : Four base pairs insertion in exon 2 of ptpmt1 : TCATATTCTTCATTCATGGTAATTACTtactCCTCTTACTTTTTCATTTTGGACCA This induced a frame shift mutation and lead to the formation of a premature stop codon. A truncated protein fragment is produced which no longer contains the catalytic domain of the phosphatase. Wild type PTPMT1 amino acid sequence: MSSVLARILFYPTLAYNVVMEKMSYRQWFNRVDATVILGALPFRSMTEELVQNEKVRGVITMNEEYETKYFCNSAEEWQSVGVEQIRLDTVDLTGVPSLEHIHKGVDFALRHREQGSSVYIHCKAGRSRSATIAAAYLIRLHCWSPEEACKMLASVRPHVLIRSSQLEMLQ. Predicted knockout PTPMT1 amino acid sequence: MSSVLARILFYPTLAYNVVMEKMSYRQWFNRVDATVILGALPFRSMTEELVQNEKVRGVSNYHE*. Peterson Lab ZDB-LAB-970909-44 Chr: 7 2019-09-17
ZDB-ALT-151111-2 f172jy Small Deletion embryos treated with TALEN2-epas1b Metelo et al (2015): 10-bp deletion in exon 3, resulting in a frameshift mutation that will affect 754 of the total 834 amino acids Yeh Lab ZDB-LAB-100305-1 Chr: 13 2019-09-17
ZDB-ALT-151109-4 f17Tg Transgenic Insertion embryos treated with DNA Peterson Lab ZDB-LAB-970909-44 Unmapped Tg(fabp1a:GAL4-VP16,UAS:NTR-mCherry) ZDB-TGCONSTRCT-151109-3 2019-09-17
ZDB-ALT-160321-2 f18Tg Transgenic Insertion embryos treated with DNA Peterson Lab ZDB-LAB-970909-44 Unmapped Tg(ubb:Mmu.Slc40a1-EGFP) ZDB-TGCONSTRCT-160321-2 2019-09-17
ZDB-ALT-160901-16 f19 Insertion embryos treated with CRISPR1-sigmar1 Randall Peterson Lab ZDB-LAB-030925-2 Chr: 10 2019-09-17
ZDB-ALT-060719-2 f1Tg f1, Tg(myl7:GFP), Tg(myl7:GFP)f1 Transgenic Insertion embryos treated with DNA The Fishman Laboratory ZDB-LAB-970409-90 Unmapped Tg(myl7:GFP) ZDB-TGCONSTRCT-070117-49 2019-09-17
ZDB-ALT-160901-17 f20 Indel embryos treated with CRISPR1-sigmar1 Randall Peterson Lab ZDB-LAB-030925-2 Chr: 10 2019-09-17
ZDB-ALT-160901-18 f21 Insertion embryos treated with CRISPR1-pgrmc1 Randall Peterson Lab ZDB-LAB-030925-2 Chr: 21 2019-09-17
ZDB-ALT-171128-1 f22Tg Transgenic Insertion embryos treated with DNA Randall Peterson Lab ZDB-LAB-030925-2 Unmapped Tg(myl7:trpa1b-2A-EGFP) ZDB-TGCONSTRCT-171128-1 2019-09-17
ZDB-ALT-151111-1 f233jy Small Deletion embryos treated with TALEN1-hif1ab Metelo et al (2015): 4-bp deletion in intron 1, causing a disruption of its splice donor site. Yeh Lab ZDB-LAB-100305-1 Chr: 20 2019-09-17
ZDB-ALT-060821-6 f2Tg Cmcl2::dsRed2-nuc, cmlc2::DsRed2-nuc, f2, Tg(-5.1myl7:nDsRed2), Tg(-5.1myl7:nDsRed2)f2, Tg(cmlc2:nuDsRed) Transgenic Insertion embryos treated with DNA DsRed2 is expressed in atrial and ventricular cardiomyocyte nuclei beginning at approximately 48 hpf. The Fishman Laboratory ZDB-LAB-970409-90 Unmapped Tg(-5.1myl7:DsRed2-NLS) ZDB-TGCONSTRCT-070117-12 2019-09-17
ZDB-ALT-080506-1 f3Tg Tg(hsp70:RUNX1T1)f3 Transgenic Insertion embryos treated with DNA Peterson Lab ZDB-LAB-970909-44 Unmapped Tg(hsp70l:Hsa.RUNX1) ZDB-TGCONSTRCT-160325-3 2019-09-17
ZDB-ALT-090520-1 f4 Insertion embryos treated with zinc finger nuclease This mutation is a 4 bp insertion induced by treatment with a custom zinc finger nuclease. Peterson Lab ZDB-LAB-970909-44 Chr: 23 2019-09-17
ZDB-ALT-071212-2 f40a fn40a Unknown adult males treated with ENU The Fishman Laboratory ZDB-LAB-970409-90 Chr: 1 2019-09-17
ZDB-ALT-090520-2 f5 Insertion embryos treated with zinc finger nuclease This mutation is a 9 bp insertion induced by treatment with a custom zinc finger nuclease. Peterson Lab ZDB-LAB-970909-44 Chr: 23 2019-09-17
ZDB-ALT-090520-3 f6 f6Df Small Deletion embryos treated with zinc finger nuclease This mutation is a 2 bp deletion induced by treatment with a custom zinc finger nuclease.; The 2 bp deletion would result in a frame shift followed by a premature stop codon, resulting in a 51 amino acid polypeptide lacking the 3 functional domains. Peterson Lab ZDB-LAB-970909-44 Chr: 23 2019-09-17
ZDB-ALT-090520-4 f7 Small Deletion embryos treated with zinc finger nuclease This mutation is a 2 bp deletion induced by treatment with a custom zinc finger nuclease. Peterson Lab ZDB-LAB-970909-44 Chr: 23 2019-09-17
ZDB-ALT-090520-5 f8 Small Deletion embryos treated with zinc finger nuclease This mutation is a 6 bp deletion induced by treatment with a custom zinc finger nuclease. Peterson Lab ZDB-LAB-970909-44 Chr: 16 2019-09-17
ZDB-ALT-090520-6 f9 Small Deletion embryos treated with zinc finger nuclease This mutation is a 4 bp deletion induced by treatment with a custom zinc finger nuclease. Peterson Lab ZDB-LAB-970909-44 Chr: 19 2019-09-17
ZDB-ALT-090616-1 fa20r CA20r Point Mutation adult males treated with ENU The mutation creates an AluI restriction site, which cleaves a 114 bp PCR product into 81 bp and 33 bp fragments. C to T transition in exon 5 encoding a Q201X truncation. The Fishman Laboratory ZDB-LAB-970409-90 Chr: 2 2019-09-17
ZDB-ALT-111213-1 fat2_unrecovered Point Mutation adult males treated with ENU Chr: 14 2019-09-17
ZDB-ALT-120427-1 fat4_unrecovered Point Mutation adult males treated with ENU Unmapped 2019-09-17
ZDB-ALT-140623-1 fb101 Indel embryos treated with zinc finger nuclease The indel mutation comprises a three nucleotide deletion and two nucleotide addition leading to a frame shift at amino acid E550.; The mutation is: E450fs; The mutation is: E450fs Langenau Lab ZDB-LAB-140429-1 Chr: 25 2019-09-17
ZDB-ALT-160323-2 fb102 Indel embryos treated with TALEN1-jak3 Langenau Lab ZDB-LAB-140429-1 Chr: 8 2019-09-17
ZDB-ALT-160323-3 fb103 Small Deletion embryos treated with TALEN2-prkdc Langenau Lab ZDB-LAB-140429-1 Chr: 7 2019-09-17
ZDB-ALT-170710-3 fb104 Small Deletion embryos treated with TALEN2-il2rga Y91A + 3rd new AA is 'Stop' Langenau Lab ZDB-LAB-140429-1 Chr: 10 2019-09-17
ZDB-ALT-190529-2 fb105 Indel embryos treated with TALEN2-tp53, TALEN3-tp53 Langenau Lab ZDB-LAB-140429-1 Chr: 5 2019-09-17
ZDB-ALT-140121-1 fb10Tg Tg(ubb:arl13b-EGFP)fb10 Transgenic Insertion embryos treated with DNA Drummond Lab ZDB-LAB-990331-4 Unmapped Tg(ubb:arl13b-EGFP) ZDB-TGCONSTRCT-140121-2 2019-09-17
ZDB-ALT-140522-4 fb11Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(hsp70l:dnMmu.Maml1-EGFP,cryaa:Cerulean) ZDB-TGCONSTRCT-140522-1 2019-09-17
ZDB-ALT-160803-2 fb121Tg Transgenic Insertion embryos treated with DNA Langenau Lab ZDB-LAB-140429-1 Unmapped Tg(myog:Hsa.HIST1H2BJ-mRFP) ZDB-TGCONSTRCT-160803-2 2019-09-17
ZDB-ALT-160803-3 fb122Tg Transgenic Insertion embryos treated with DNA Langenau Lab ZDB-LAB-140429-1 Unmapped Tg(mylpfa:LY-CFP) ZDB-TGCONSTRCT-160803-1 2019-09-17
ZDB-ALT-140522-5 fb12Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(hsp70l:MYC-notch1a,cryaa:Cerulean) ZDB-TGCONSTRCT-140522-2 2019-09-17
ZDB-ALT-140522-6 fb13Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(kdrl:Cre-ERT2) ZDB-TGCONSTRCT-140522-3 2019-09-17
ZDB-ALT-140618-1 fb14Tg fb10 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(hsp70l:dnMmu.Maml1-EGFP,cryaa:Cerulean) ZDB-TGCONSTRCT-140522-1 2019-09-17
ZDB-ALT-160421-4 fb15 Small Deletion embryos treated with TALEN1-fosl2 fb15 allele harbors an 18bp deletion, removal of 6 amino acid near the N-terminus Burns Lab ZDB-LAB-090325-1 Ambiguous 2019-09-17
ZDB-ALT-160421-5 fb16 Small Deletion embryos treated with TALEN1-fosl2 fb16 allele harbors a 16bp deletion. Consequences: Frameshift, premature stop, protein truncation Burns Lab ZDB-LAB-090325-1 Ambiguous 2019-09-17
ZDB-ALT-161006-1 fb17Tg fb16 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(ubb:LOXP-MKATE2-LOXP-dnMmu.Maml1-EGFP) ZDB-TGCONSTRCT-160915-1 2019-09-17
ZDB-ALT-180717-4 fb18Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg2(myl7:NLS-EGFP) ZDB-TGCONSTRCT-180717-4 2019-09-17
ZDB-ALT-180717-5 fb19Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(myl7:EGFP-2A-dnect2) ZDB-TGCONSTRCT-180717-5 2019-09-17
ZDB-ALT-111115-2 fb1Tg TgBAC(-25ltbp3:TagRFP-Cre)fb1 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped TgBAC(-25ltbp3:TagRFP-Cre) ZDB-TGCONSTRCT-111115-2 2019-09-17
ZDB-ALT-140818-1 fb201Tg Transgenic Insertion embryos treated with DNA Drummond Lab ZDB-LAB-990331-4 Unmapped Tg(shhb:GAL4) ZDB-TGCONSTRCT-140818-1 2019-09-17
ZDB-ALT-150504-5 fb202Tg Transgenic Insertion embryos treated with DNA Drummond Lab ZDB-LAB-990331-4 Unmapped Tg(nphs2:GAL4-VP16) ZDB-TGCONSTRCT-150504-7 2019-09-17
ZDB-ALT-180717-6 fb20Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(myl7:LOXP-NLS-mKOFP-2A-FLPoERT2-LOXP-MA-GFP) ZDB-TGCONSTRCT-180717-6 2019-09-17
ZDB-ALT-181211-2 fb20a Small Deletion embryos treated with CRISPR3-gdf3 Burns Lab ZDB-LAB-090325-1 Chr: 17 2019-09-17
ZDB-ALT-180717-7 fb21Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(myl7:LOXP-NLS-mKOFP-2A-FLPo-LOXP-MA-GFP) ZDB-TGCONSTRCT-180717-7 2019-09-17
ZDB-ALT-180717-8 fb22Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(hsp70l:FRT-NLS-PhiYFP-FRT-NLS-Cre-2A-dnect2,cryaa:ZsYellow) ZDB-TGCONSTRCT-180717-8 2019-09-17
ZDB-ALT-181029-5 fb23Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped TgBAC(tbx1:MKATE2-2A-Cre) ZDB-TGCONSTRCT-181029-4 2019-09-17
ZDB-ALT-181029-4 fb25Tg Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped TgBAC(tbx1:GFP) ZDB-TGCONSTRCT-181029-5 2019-09-17
ZDB-ALT-111115-3 fb2Tg Tg(myl7:LOXP-AmCyan-LOXP-ZsYellow)fb2 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(myl7:LOXP-AmCyan-LOXP-ZsYellow) ZDB-TGCONSTRCT-111115-3 2019-09-17
ZDB-ALT-180712-2 fb301Tg Transgenic Insertion embryos treated with DNA Galloway Lab ZDB-LAB-180703-1 Unmapped Tg(scxa:mCherry) ZDB-TGCONSTRCT-180712-1 2019-09-17
ZDB-ALT-111115-4 fb3Tg TgBAC_AL935131(kdrl:LOXP-AmCyan-LOXP-ZsYellow)fb3, TgBAC(kdrl:LOXP-AmCyan-LOXP-ZsYellow)fb3 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped TgBAC(kdrl:LOXP-AmCyan-LOXP-ZsYellow) ZDB-TGCONSTRCT-111115-4 2019-09-17
ZDB-ALT-111115-5 fb4Tg TgBAC_CU302322(elnb:LOXP-AmCYan-LOXP-ZsYellow)fb4, TgBAC(elnb:LOXP-AmCYan-LOXP-ZsYellow)fb4 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped TgBAC(elnb:LOXP-AmCyan-LOXP-ZsYellow) ZDB-TGCONSTRCT-111115-5 2019-09-17
ZDB-ALT-111115-6 fb5Tg Tg(ubb:LOXP-AmCyan-LOXP-ZsYellow)fb5 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(ubb:LOXP-AmCyan-LOXP-ZsYellow) ZDB-TGCONSTRCT-111115-6 2019-09-17
ZDB-ALT-111115-7 fb6Tg Tg(hsp70l:Hsa.TGFBR1_T204D-HA,cryaa:ECFP)fb6 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped Tg(hsp70l:Hsa.TGFBR1_T204D-HA,cryaa:Cerulean) ZDB-TGCONSTRCT-111115-7 2019-09-17
ZDB-ALT-111115-8 fb7Tg TgBAC(-36nkx2.5:ZsYellow)fb7, TgBAC_CR812847(-36nkx2.5:ZsYellow)fb7 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped TgBAC(-36nkx2.5:ZsYellow) ZDB-TGCONSTRCT-111115-8 2019-09-17
ZDB-ALT-130411-1 fb8Tg TgBAC(nkx2.5:ERT2-CreERT2)fb8, TgBAC(nkx2.5:ERT2CreERT2)fb8 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped TgBAC(nkx2.5:ERT2-Cre-ERT2) ZDB-TGCONSTRCT-130411-1 2019-09-17
ZDB-ALT-130411-2 fb9Tg TgBAC(nkx2.5:Kaede)fb9 Transgenic Insertion embryos treated with DNA Burns Lab ZDB-LAB-090325-1 Unmapped TgBAC(nkx2.5:Kaede) ZDB-TGCONSTRCT-130411-2 2019-09-17
ZDB-ALT-160426-18 fcc118Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc118 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf and 6 dpf is ubiquitous. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-1 fcc143Gt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA GFP epxression at 2 dpf in the AGM and PBI and at 6 dpf in the thymus epithelium. Rhodes Lab ZDB-LAB-080522-1 Chr: 21 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-24 fcc144p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc144-P1 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in the posterior eye, brain, dorsal muscles and gills. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-25 fcc144p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc144-P2 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in muscle, liver, intestine, skin. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-26 fcc144p3Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc144-P3 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in the hear and trunk muscles. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160425-7 fcc24Gt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in PBI and circulation. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-16 fcc27Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc27 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf and 6 dpf in the kidney and blood vessels in the head. Rhodes Lab ZDB-LAB-080522-1 Chr: 23 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-2 fcc301Gt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf and 6 dpf in the AGM, kidney, nerves, circulation. Rhodes Lab ZDB-LAB-080522-1 Chr: 8 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-13 fcc313Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc313 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in kidney tubules and at 6 dpf in liver ducts. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-27 fcc316Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc316 Transgenic Insertion embryos treated with DNA GFP expression at 2dpf in the nasal epithelium, weak expression at 6 dpf. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-28 fcc322Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc322 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in the middle of intestine. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-20 fcc337p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc337-P1 Transgenic Insertion embryos treated with DNA Strong GFP expression at 2 dpf and 6 dpf is ubiquitous. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-10 fcc337p2Et This feature is representative of one or more unknown insertion sites. fcc337p2Gt, Tg(GBT-B4)fcc337-P2 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in the thymus. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-29 fcc360p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc360-P1 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in cells of the ear canals. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-30 fcc360p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc360-P2 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in the notochord and canal under distal ear. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-14 fcc360p3Gt This feature is representative of one or more unknown insertion sites. fcc360-p3Gt, Tg(GBT-B4)fcc360-P3 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf and 6 dpf in the anterior kidney tubules. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-31 fcc363p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc363-P1 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf and 6 dpf in the intestine. Rhodes Lab ZDB-LAB-080522-1 Chr: 14 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-15 fcc363p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc363-P2 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in the kidney corpuscles of Stannius. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-33 fcc374p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc374-P1 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in forebrain and tectum. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-32 fcc374p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc374-P2 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in the ear canal, nose and notochord. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-34 fcc382p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc382-P1 Transgenic Insertion embryos treated with DNA GFP epxression at 2 dpf in neural tube, blood vessels or nerves and at 6 dpf in nerves in hindbrain. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-35 fcc382p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc382-P2 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in nerves in the brain, vagus nerve and jaw. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-4 fcc403Gt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the PBI, blood vessels, notochord, skin and at 6dpf in the circulation, intestine, and liver. Rhodes Lab ZDB-LAB-080522-1 Chr: 7 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-36 fcc413Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc413 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in bones/cartilage in jaw. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-37 fcc418p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc418-P1 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the epiphysis, dorsal eye, hindbrain, spinal cord and at 6 dpf in the brain, hypophysis and eye. Rhodes Lab ZDB-LAB-080522-1 Chr: 25 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-38 fcc418p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc418-P2 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in a stripe in the brain. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-39 fcc420Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc420 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in trunk muscle and cells around the heart. Rhodes Lab ZDB-LAB-080522-1 Chr: 1 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-40 fcc423p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc423-P1 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the retina fusion zone and at 6 dpf in a subset of photoreceptor cells. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-41 fcc423p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc423-P2 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in nerves between the eyes. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-5 fcc436p1Gt This feature is representative of one or more unknown insertion sites. fcc436-P1Gt Transgenic Insertion embryos treated with DNA GFP expression at 2dpf in the vessels, PBI, AGM, hatching gland, skin and at 6 dpf in the pancreas, distal intestine, kidney, skin, vessels, circulation. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-42 fcc436p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc436-P2 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in muscles of the jaw and trunk. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-43 fcc436p3Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc436-P3 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf and 6 dpf in skin cells. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-190520-9 fcc43Tg Transgenic Insertion embryos treated with DNA Rhodes Lab ZDB-LAB-080522-1 Unmapped Tg(-8cd79b:EGFP) ZDB-TGCONSTRCT-190520-4 2019-09-17
ZDB-ALT-160426-44 fcc443Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc443 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in forebrain and no expression at 6dpf. Rhodes Lab ZDB-LAB-080522-1 Chr: 9 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-45 fcc458Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc458 Transgenic Insertion embryos treated with DNA GFP expression at 2dpf in notochord and no expression at 6 dpf. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-46 fcc460Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc460 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf and 6 dpf in skin cells. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-17 fcc474p1Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc474P1 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the skin and eye and at 6 dpf in the neural tube, eye, and kidney. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-47 fcc475Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc475 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in forebrain and at 6 dpf in cells in the brain. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-11 fcc510Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B$)fcc510 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the PBI, notochord and kidney and at 6 dpf in the notochord,kidney, and enteric nervous system. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-48 fcc516Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc516 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the brain (weak) and at 6 dpf in neurons in the eye. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-7 fcc522Gt This feature is representative of one or more unknown insertion sites. fcc522Tg, Tg(GBT-B4)fcc522 Transgenic Insertion DNA GFP expression at 2 dpf in the skin, PBI and at 6 dpf in vessels, intestine, and circulation. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-8 fcc559Gt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in cells in the AGM and at 6 dpf in cells of the anterior kidney. Rhodes Lab ZDB-LAB-080522-1 Chr: 5 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-23 fcc5770Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc57-70 Transgenic Insertion embryos treated with DNA GFP expression at 6 dpf in skin cells, anus, and ear. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-21 fcc618Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc618 Transgenic Insertion embryos treated with DNA Weak ubiquitous GFP expression at 2 dpf and no GFP expression at 6 dpf. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-49 fcc629Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc629 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in trunk muscle and brain and ubiquitous at 6 dpf, more prominent in the thymus. Rhodes Lab ZDB-LAB-080522-1 Chr: 12 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-50 fcc634Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc634 Transgenic Insertion embryos treated with DNA GFP expression at 2 and 6 dpf in skin on head. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-190520-8 fcc64Tg Transgenic Insertion embryos treated with DNA Rhodes Lab ZDB-LAB-080522-1 Unmapped Tg(-8cd79b:EGFP) ZDB-TGCONSTRCT-190520-4 2019-09-17
ZDB-ALT-160426-51 fcc652Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc652 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the neural tube, and motoneuron and at 6 dpf in motoneuron, enteric nervous system and hair cells. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-9 fcc667Gt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA GFP expression at 2dpf in blood vessels, PBI and at 6 dpf in vessels and circulation. Rhodes Lab ZDB-LAB-080522-1 Chr: 24 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-52 fcc683Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc683 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the forebrain and eye. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-12 fcc688Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc688 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf in the PBI, skin, kidney, nose, notochord and at 6 dpf in the skin, kidney, spinal chord, hair cells (ear), intestine Rhodes Lab ZDB-LAB-080522-1 Chr: 5 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-22 fcc711Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc711 Transgenic Insertion embryos treated with DNA Ubiquitous GFP expression at 2 dpf and 6 dpf. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-180129-1 fcc88Tg Transgenic Insertion embryos treated with DNA Rhodes Lab ZDB-LAB-080522-1 Unmapped Tg(-14cd79a:EGFP) ZDB-TGCONSTRCT-180129-3 2019-09-17
ZDB-ALT-160425-8 fcc88p1Gt This feature is representative of one or more unknown insertion sites. fcc88-P1 Transgenic Insertion embryos treated with DNA GFP expression at 2 dpf and 6 dpf in the skin and circulation. Rhodes Lab ZDB-LAB-080522-1 Chr: 2 Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-160426-19 fcc88p2Gt This feature is representative of one or more unknown insertion sites. Tg(GBT-B4)fcc88-P2 Transgenic Insertion embryos treated with DNA Weak GFP expression at 2 dpf and 6 dpf is ubiquitous. Rhodes Lab ZDB-LAB-080522-1 Unmapped Gt(LOXP-GAL4-VP16-FRT,5xUAS:EGFP-FRT-LOXP) ZDB-GTCONSTRCT-151022-1 2019-09-17
ZDB-ALT-180724-4 fcc89Tg Line A Transgenic Insertion embryos treated with DNA Rhodes Lab ZDB-LAB-080522-1 Unmapped Tg(-5cd79b:EGFP) ZDB-TGCONSTRCT-180725-1 2019-09-17
ZDB-ALT-180724-5 fcc90Tg Line B Transgenic Insertion embryos treated with DNA Rhodes Lab ZDB-LAB-080522-1 Unmapped Tg(-5cd79b:EGFP) ZDB-TGCONSTRCT-180725-1 2019-09-17
ZDB-ALT-180129-2 fcc97Tg Transgenic Insertion embryos treated with DNA Rhodes Lab ZDB-LAB-080522-1 Unmapped Tg(-14cd79a:EGFP) ZDB-TGCONSTRCT-180129-3 2019-09-17
ZDB-ALT-160301-1 fci100Tg Transgenic Insertion embryos treated with DNA Hill Lab ZDB-LAB-110602-1 Unmapped Tg(ARE:EGFP) ZDB-TGCONSTRCT-160301-1 2019-09-17
ZDB-ALT-161220-4 fci1Tg Transgenic Insertion embryos treated with DNA Wilkinson Lab ZDB-LAB-100915-2 Unmapped Tg2(hsp70l:GAL4) ZDB-TGCONSTRCT-161220-5 2019-09-17
ZDB-ALT-170321-1 fci200 Small Deletion embryos treated with TALEN1-mapk10 Pachnis Lab ZDB-LAB-170314-1 Chr: 21 2019-09-17
ZDB-ALT-181001-5 fci3Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR10-egr2b Wilkinson Lab ZDB-LAB-100915-2 Unmapped Tg(Mmu.Fos:Hsa.HIST1H2BJ-Citrine) ZDB-TGCONSTRCT-181001-3 2019-09-17
ZDB-ALT-180212-3 fci400 Small Deletion embryos treated with TALEN1-tmem88a Jim Smith Lab ZDB-LAB-970409-78 Chr: 10 2019-09-17
ZDB-ALT-181001-6 fci4Tg Transgenic Insertion embryos treated with DNA Wilkinson Lab ZDB-LAB-100915-2 Unmapped Tg(hsp70l:egr2b-MYC,cryaa:EGFP) ZDB-TGCONSTRCT-181001-2 2019-09-17
ZDB-ALT-150527-2 fcu1Tg Transgenic Insertion embryos treated with DNA Targoff Lab ZDB-LAB-110322-1 Unmapped Tg(hsp70l:nkx2.5-EGFP) ZDB-TGCONSTRCT-150527-1 2019-09-17
ZDB-ALT-180830-1 fdu101Tg Transgenic Insertion embryos treated with DNA Xu Wang Lab ZDB-LAB-170210-5 Unmapped Tg(elavl3:RFP) ZDB-TGCONSTRCT-180830-1 2019-09-17
ZDB-ALT-110309-1 fdu1Tg Tg(Xla.Vtga2-vtg1:EGFP)fdu1 Transgenic Insertion embryos treated with DNA Song Lab ZDB-LAB-060807-1 Unmapped Tg(Xla.Vtga2-vtg1:EGFP) ZDB-TGCONSTRCT-110309-1 2019-09-17
ZDB-ALT-181128-2 fdu201 Indel embryos treated with CRISPR1-shank3b Xui Xu Lab ZDB-LAB-181127-1 Chr: 4 2019-09-17
ZDB-ALT-190906-1 fdu30 Small Deletion embryos treated with CRISPR1-csrp3 Ruilin Zhang Lab ZDB-LAB-170210-2 Chr: 7 2019-09-17
ZDB-ALT-190221-2 fdu6Tg Transgenic Insertion embryos treated with DNA Xu Wang Lab ZDB-LAB-170210-5 Unmapped Tg(actb2:mCherry-Hsa.MBD1-NLS-EGFP) ZDB-TGCONSTRCT-190221-3 2019-09-17
ZDB-ALT-050209-36 fgf3_unspecified un_fgf3, unspecified_fgf3 Unspecified Chr: 7 2019-09-17
ZDB-ALT-050209-6 fgf8a_unspecified un_ace, un_fgf8a, unspecified_fgf8a Unspecified Ambiguous 2019-09-17
ZDB-ALT-091112-1 fh095 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 12 2019-09-17
ZDB-ALT-061129-4 fh105 Point Mutation adult males treated with ENU fh105 is a C-to-A substitution at nucleotide 300 of eomesa, resulting in replacement of tyrosine 100 with a stop codon. Very probably null. Homozygous viable. Moens Lab ZDB-LAB-990225-6 Chr: 19 2019-09-17
ZDB-ALT-160602-14 fh111 Point Mutation Moens Lab ZDB-LAB-990225-6 Chr: 13 2019-09-17
ZDB-ALT-100504-3 fh112 Point Mutation adult females treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 4 2019-09-17
ZDB-ALT-061129-14 fh117 Point Mutation adult males treated with ENU This is a A-to-T mutation at nucleotide 558, resulting in a stop codon at amino acid 157. Moens Lab ZDB-LAB-990225-6 Ambiguous 2019-09-17
ZDB-ALT-110819-4 fh122 Point Mutation adult males treated with ENU A missense mutation (G to T) in fh122 mutants leads to a C869F amino acid change in the farnesylation (CaaX) motif of Prickle1b. As this cysteine is obligatory for attachment of the farnesyl group it is expected that pk1b fh122 mutants will completely lack farnesylation of the Pk1b protein.
( adapted from Mapp et al. 2011 ) Moens Lab ZDB-LAB-990225-6 Chr: 4 2019-09-17
ZDB-ALT-120515-1 fh131 Point Mutation adult males treated with ENU nucleotide substitution: G to T; mutated amino acid: E1219X Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-110421-1 fh1Tg Tg(isl1-hsp70l:mRFP)fh1 Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(isl1-hsp70l:mRFP) ZDB-TGCONSTRCT-110201-1 2019-09-17
ZDB-ALT-051112-2 fh20 Point Mutation C-T transition corresponding to position 1904 of the spt5 mRNA. fh20 is a hypomorphic cryptic splice allele of foggy/spt5. Moens Lab ZDB-LAB-990225-6 Ambiguous 2019-09-17
ZDB-ALT-061129-10 fh219 Point Mutation adult males treated with ENU This is a C-to-T mutation at nucleotide 1681, resulting in a stop codon at amino acid 561. Moens Lab ZDB-LAB-990225-6 Chr: 8 2019-09-17
ZDB-ALT-091112-2 fh220 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 8 2019-09-17
ZDB-ALT-080123-1 fh221 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 8 2019-09-17
ZDB-ALT-061129-20 fh224 Point Mutation adult males treated with ENU This is a G-to-T mutation at nucleotide 280, resulting in a stop codon at amino acid 94. Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-091112-3 fh225 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-061129-2 fh227 Point Mutation adult males treated with ENU Introduces a C->A substitution at position 1002 producing a premature TGA stop codon at amino acid 334. Moens Lab ZDB-LAB-990225-6 Chr: 12 2019-09-17
ZDB-ALT-061129-22 fh228 Point Mutation adult males treated with ENU This is a G-to-A mutation at nucleotide 4072, resulting in a stop codon at amino acid 1358. Moens Lab ZDB-LAB-990225-6 Unmapped 2019-09-17
ZDB-ALT-061129-16 fh229 smnY262stop, T6044A, Y260* Point Mutation adult males treated with ENU This is a T-to-A mutation resulting in a stop codon at amino acid 262. Moens Lab ZDB-LAB-990225-6 Chr: 5 2019-09-17
ZDB-ALT-100216-1 fh230 L263*, smnL265stop, T6139A Point Mutation adult males treated with ENU This is a T-A mutation resulting in a stop-codon at amino acid 265. Moens Lab ZDB-LAB-990225-6 Chr: 5 2019-09-17
ZDB-ALT-100216-2 fh231 G262D, G6136A, smnG264D Point Mutation adult males treated with ENU This is a G-A missense mutation, converting G264 to D. Moens Lab ZDB-LAB-990225-6 Chr: 5 2019-09-17
ZDB-ALT-061129-6 fh232 Q63* Point Mutation adult males treated with ENU This is a C-to-T mutation at nucleotide 187, resulting in a nonsense mutation and putatively truncating the protein at position 63. Moens Lab ZDB-LAB-990225-6 Chr: 8 2019-09-17
ZDB-ALT-091112-4 fh234 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 4 2019-09-17
ZDB-ALT-061129-18 fh235 Point Mutation adult males treated with ENU This is a T-to-A mutation at nucleotide 664, resulting in a C to S change at amino acid 222. Moens Lab ZDB-LAB-990225-6 Chr: 4 2019-09-17
ZDB-ALT-061129-12 fh236 Point Mutation adult males treated with ENU This is a T-to-A mutation at nucleotide 302, resulting in a stop codon at amino acid 101. Moens Lab ZDB-LAB-990225-6 Chr: 9 2019-09-17
ZDB-ALT-070803-1 fh241 Point Mutation ENU Moens Lab ZDB-LAB-990225-6 Chr: 23 2019-09-17
ZDB-ALT-091112-5 fh243 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 1 2019-09-17
ZDB-ALT-070803-2 fh244 Point Mutation ENU Moens Lab ZDB-LAB-990225-6 Chr: 12 2019-09-17
ZDB-ALT-071015-3 fh245 Point Mutation This is a mutation at the intron2-exon3 splice junction. Moens Lab ZDB-LAB-990225-6 Chr: 1 2019-09-17
ZDB-ALT-071015-6 fh246 rip140b Point Mutation The mutation in the cDNA is c694t. Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-071015-4 fh247 Point Mutation The mutation in the cDNA is c505t. Moens Lab ZDB-LAB-990225-6 Chr: 19 2019-09-17
ZDB-ALT-091112-6 fh248 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 6 2019-09-17
ZDB-ALT-071015-2 fh250 Point Mutation The mutation in the cDNA is c597a. Moens Lab ZDB-LAB-990225-6 Chr: 12 2019-09-17
ZDB-ALT-071019-5 fh252 wntless Point Mutation ENU Kuan et al (2015): a nonsense mutation (C to T) in the third exon of the wls homolog (CAG>TAG in exon 3) Moens Lab ZDB-LAB-990225-6 Chr: 2 2019-09-17
ZDB-ALT-071015-1 fh253 Point Mutation The mutation in the cDNA is c597a. Moens Lab ZDB-LAB-990225-6 Chr: 6 2019-09-17
ZDB-ALT-091112-7 fh255 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 12 2019-09-17
ZDB-ALT-071015-5 fh258 Point Mutation The mutation in the cDNA is c429a.
fh258 is a mutation in the tgif1 gene which introduces a stop codon (Y143X) and produces a truncated protein (~18 kDa). WT fish express only the full-length Tgif1 protein (~35 kDa). Moens Lab ZDB-LAB-990225-6 Chr: 24 2019-09-17
ZDB-ALT-080325-4 fh260 Point Mutation ENU Mutation c313a, Y104stop, sequence may not be full length. Moens Lab ZDB-LAB-990225-6 Chr: 1 2019-09-17
ZDB-ALT-080325-6 fh261 Point Mutation ENU Mutation A376T, R126stop. Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-091112-8 fh263 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 9 2019-09-17
ZDB-ALT-080325-7 fh265 Point Mutation ENU Mutation C499T, Q167stop. Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-080325-8 fh266 Point Mutation ENU Mutation C292T, Q98stop. Moens Lab ZDB-LAB-990225-6 Chr: 19 2019-09-17
ZDB-ALT-080325-9 fh267 Point Mutation ENU Mutation G931T. . Splice site mutation at the exon 1/intron1 boundary truncates protein 19aa after the end of exon1 (aa310) (full length protein is 1623aa). Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-080325-3 fh271 Point Mutation ENU Mutation c736t, Q246stop. Moens Lab ZDB-LAB-990225-6 Chr: 24 2019-09-17
ZDB-ALT-080325-5 fh273 Point Mutation ENU Mutation c274t, Q92stop.
The msgn1 fh273 allele carries a point mutation that substitutes the cytosine at position 274 with a thymine, changing the glutamine at position 92 into a stop codon. The resulting protein is truncated in the middle of the first helix of the HLH motif. Homozygous msgn1 fh273 mutants are viable. Moens Lab ZDB-LAB-990225-6 Chr: 4 2019-09-17
ZDB-ALT-091112-10 fh274 Point Mutation adult males treated with ENU (C11527T; Q924), generate amber stop codon, predicted to truncate the protein early in the extracellular domains Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-090715-2 fh275 Point Mutation ENU On XM_677713 the mutated nucleotide is c3064t leading to Q1022*. Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-091112-11 fh276 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Ambiguous 2019-09-17
ZDB-ALT-091112-12 fh277 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Ambiguous 2019-09-17
ZDB-ALT-090715-3 fh278 Point Mutation ENU Mutation T347A gives a coding change of L116*. Moens Lab ZDB-LAB-990225-6 Chr: 2 2019-09-17
ZDB-ALT-091112-13 fh279 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 2 2019-09-17
ZDB-ALT-091112-14 fh280 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-091112-15 fh281 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-091112-16 fh282 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 8 2019-09-17
ZDB-ALT-091112-17 fh283 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 6 2019-09-17
ZDB-ALT-091112-19 fh286 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 12 2019-09-17
ZDB-ALT-091112-20 fh288 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 5 2019-09-17
ZDB-ALT-091112-21 fh290 Point Mutation adult males treated with ENU Mutation is a nonsense point mutation C290T in exon1a, which changes glutamine at residue 61 to a stop codon resulting in a protein truncated at the end of the first extracellular loop. Moens Lab ZDB-LAB-990225-6 Chr: 15 2019-09-17
ZDB-ALT-091112-22 fh291 L115X Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 13 2019-09-17
ZDB-ALT-091112-23 fh292 Y472X Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 13 2019-09-17
ZDB-ALT-120126-2 fh293 Point Mutation embryos treated with ENU A nonsense mutation in ush1c from the Zebrafish TILLING Consortium was obtained by screening for mutations in the first PDZdomain-encoding region of ush1c (PDZ1). The line,ush1cfh293, harbors a nonsense mutation in the fifth exon, which encodes the C-terminal portion of the PDZ1 domain. Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-091112-24 fh294 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-091112-25 fh295 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-091112-26 fh296 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 2 2019-09-17
ZDB-ALT-091112-27 fh297 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-091112-28 fh298 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 23 2019-09-17
ZDB-ALT-091112-29 fh299 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 23 2019-09-17
ZDB-ALT-110421-2 fh2Tg TgBAC(egr2b:GFP)fh2 Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped TgBAC(egr2b:GFP) ZDB-TGCONSTRCT-110421-1 2019-09-17
ZDB-ALT-091112-30 fh300 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-091112-31 fh301 Y220X Point Mutation adult males treated with ENU This allele has a single nucleotide change 660C>A resulting in a premature stop codon (TAC -> TAA), p.Y220X which truncates the 413aa protein midway through its second RNA binding domain. Moens Lab ZDB-LAB-990225-6 Chr: 6 2019-09-17
ZDB-ALT-091112-32 fh302 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 1 2019-09-17
ZDB-ALT-091112-33 fh303 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 1 2019-09-17
ZDB-ALT-091112-34 fh304 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-091112-35 fh305 Point Mutation adult males treated with ENU The fh305 mutation changes a tyrosine at amino acid position 203 to a stop codon. This mutation is predicted to truncate the protein after the conserved oligomerization domain and before the PDZ domains. This allele truncates all 3 predicted pard3 isoforms. Moens Lab ZDB-LAB-990225-6 Chr: 2 2019-09-17
ZDB-ALT-091112-36 fh306 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 13 2019-09-17
ZDB-ALT-091112-37 fh307 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 13 2019-09-17
ZDB-ALT-091112-38 fh308 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 13 2019-09-17
ZDB-ALT-091112-39 fh309 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-091112-40 fh310 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-091112-41 fh311 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 7 2019-09-17
ZDB-ALT-091112-42 fh312 Point Mutation adult males treated with ENU fh312 carries an ENU-induced stop codon (L74*) in kctd12.2. Null mutation - no protein detected in homozygotes by immunofluorescence. Homozygous viable. Moens Lab ZDB-LAB-990225-6 Chr: 1 2019-09-17
ZDB-ALT-100311-9 fh313 Point Mutation adult males treated with ENU An A to T transversion at position 302 leads to a premature stop codon at Lys68. Moens Lab ZDB-LAB-990225-6 Chr: 3 2019-09-17
ZDB-ALT-100311-10 fh314 Point Mutation adult males treated with ENU fh314 homozygotes exhibit a C to T conversion in the rpgrip1 gene which resulted in a nonsense mutation, changing a glutamine codon to stop (CAG to TAG). We predicted that the nonsense mutation would lead to either a truncated 735 amino acid polypeptide and/or nonsense-mediated RNA decay (NMD). Quantitative real-time PCR showed rpgrip1 mRNA was decreased by about 85% in 5 dpf rpgrip1−/− embryos when compared to wildtype siblings, confirming that NMD was most likely occurring. Both heterozygous and homozygous rpgrip1 mutant fish exhibited normal external morphology and were fertile. Mutant larvae developed a normal swim bladder. All the examined homozygous rpgrip1 fish showed same phenotypes, suggesting complete penetrance. There is no variable expressivity. Moens Lab ZDB-LAB-990225-6 Chr: 24 2019-09-17
ZDB-ALT-100311-11 fh315 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 24 2019-09-17
ZDB-ALT-100311-13 fh317 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 8 2019-09-17
ZDB-ALT-100311-14 fh318 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 9 2019-09-17
ZDB-ALT-100311-15 fh319 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 9 2019-09-17
ZDB-ALT-100311-16 fh320 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-100311-17 fh321 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-100311-18 fh322 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-100311-19 fh323 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-100311-20 fh324 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 14 2019-09-17
ZDB-ALT-100311-21 fh325 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 14 2019-09-17
ZDB-ALT-101008-11 fh326 Point Mutation adult males treated with ENU Pan et al (2015): C > T mutation resulting in a nonsense mutation, R120X. Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-101008-12 fh327 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-101008-13 fh328 Point Mutation adult males treated with ENU This is a missense mutation (c.241T > G) resulting in the substitution of a conserved isoleucine for an arginine in the first transmembrane domain. Moens Lab ZDB-LAB-990225-6 Chr: 18 2019-09-17
ZDB-ALT-101008-14 fh329 Point Mutation adult males treated with ENU protein truncation after the first transmembrane domain Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-101008-15 fh330 Point Mutation adult males treated with ENU A nonsense mutation which confers an early stop codon at L150. Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-101008-16 fh331 Point Mutation adult males treated with ENU A nonsense mutation which confers an early stop codon at L174. Moens Lab ZDB-LAB-990225-6 Chr: 11 2019-09-17
ZDB-ALT-101008-17 fh332 Point Mutation adult males treated with ENU notch3 fh332 harbors a nonsense mutation that introduces a premature stop codon at amino acid position 669 within the 8th Notch3 EGF repeat. The mutation is expected to generate a non-functional truncated protein lacking most of the extracellular and all of the transmembrane and intracellular domains of Notch3. fh332/fh332 homozygous embryos and larvae developed at normal speed and without apparent morphological defects, although the mutation was lethal before adulthood. Moens Lab ZDB-LAB-990225-6 Chr: 3 2019-09-17
ZDB-ALT-101008-19 fh334 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 3 2019-09-17
ZDB-ALT-101008-21 fh336 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 9 2019-09-17
ZDB-ALT-101008-22 fh337 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 15 2019-09-17
ZDB-ALT-101008-23 fh338 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 24 2019-09-17
ZDB-ALT-111010-10 fh339 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 8 2019-09-17
ZDB-ALT-111010-11 fh340 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 21 2019-09-17
ZDB-ALT-111010-12 fh341 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 24 2019-09-17
ZDB-ALT-120710-2 fh342 Point Mutation adult males treated with ENU T(WT) to G(mut) Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-111010-13 fh343 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-111010-14 fh344 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 5 2019-09-17
ZDB-ALT-111010-15 fh345 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 2 2019-09-17
ZDB-ALT-111010-16 fh346 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 2 2019-09-17
ZDB-ALT-111010-17 fh347 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 7 2019-09-17
ZDB-ALT-111010-18 fh348 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 17 2019-09-17
ZDB-ALT-111010-19 fh349 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 17 2019-09-17
ZDB-ALT-170224-6 fh350Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped 2019-09-17
ZDB-ALT-111010-20 fh351 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-111010-21 fh352 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-120309-2 fh353 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-160825-2 fh360 dis3, disconnect3 Complex ENU "The ENU mutagensis produced two missense mutations in gjd1a. We have not resolved causation to one or both mutations." Miller et al., 2017.; 2 missense mutations : K215Q; R290C Moens Lab ZDB-LAB-990225-6 Chr: 5 2019-09-17
ZDB-ALT-150720-1 fh364 Point Mutation adult females treated with ENU Miller et al (2015): mutation has a C to T transition in exon 21 introducing a nonsense codon that truncates the protein approximately one third of the way through the protein Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-180828-3 fh367 Small Deletion embryos treated with TALEN1-atoh1c fh367 has a TALEN-generated 122 bp deletion in atoh1c that results in a premature stop codon before the Atoh1c DNA binding domain. Moens Lab ZDB-LAB-990225-6 Chr: 12 2019-09-17
ZDB-ALT-160901-15 fh378 Small Deletion embryos treated with TALEN1-cep290 Deletion of c294 and c295. frame shift after A99. Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-150720-3 fh380 Indel embryos treated with TALEN2-nbeaa Miller et al (2015) loss of 9 base pairs, and an introduction of one base pair in exon 21, resulting in a net change of 8 base pairs causing a frame shift. This change is predicted to introduce 43 different amino acids before encountering a new nonsense codon and truncating the protein. Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-170126-6 fh390 Unknown Moens Lab ZDB-LAB-990225-6 Chr: 24 2019-09-17
ZDB-ALT-150720-2 fh392 Small Deletion embryos treated with TALEN1-nbeaa Miller et al (2015) a loss of 7 base pairs in exon 1 , causing a frame shift that is predicted to introduce a nonsense mutation directly after the deletion at amino acid 95. Moens Lab ZDB-LAB-990225-6 Chr: 10 2019-09-17
ZDB-ALT-110421-3 fh3Tg TgBAC(hoxb1a:RFP)fh3 Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped TgBAC(hoxb1a:RFP) ZDB-TGCONSTRCT-110421-2 2019-09-17
ZDB-ALT-180828-2 fh430Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped TgBAC(atoh1c:GAL4FF) ZDB-TGCONSTRCT-180828-1 2019-09-17
ZDB-ALT-160825-4 fh435 Small Deletion embryos treated with TALEN1-gjd1b Moens Lab ZDB-LAB-990225-6 Chr: 15 2019-09-17
ZDB-ALT-160825-3 fh436 Small Deletion embryos treated with TALEN1-gjd1a Moens Lab ZDB-LAB-990225-6 Chr: 5 2019-09-17
ZDB-ALT-160825-5 fh437 Small Deletion embryos treated with TALEN1-gjd2a Moens Lab ZDB-LAB-990225-6 Chr: 17 2019-09-17
ZDB-ALT-160923-2 fh438 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 5 2019-09-17
ZDB-ALT-160923-1 fh440 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-170224-7 fh444Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(isl1-hsp70l:Xla.Dvl2-GFP) ZDB-TGCONSTRCT-170224-7 2019-09-17
ZDB-ALT-170224-8 fh446Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(10xUAS:Xla.Dvl2-GFP) ZDB-TGCONSTRCT-170224-8 2019-09-17
ZDB-ALT-170224-9 fh447Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(10xUAS:fzd3a-GFP) ZDB-TGCONSTRCT-170224-9 2019-09-17
ZDB-ALT-160825-6 fh448 Small Deletion embryos treated with CRISPR1-tjp1b Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-160825-7 fh449 Indel embryos treated with CRISPR1-tjp1b Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-160923-3 fh450 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 16 2019-09-17
ZDB-ALT-160825-8 fh451 Indel embryos treated with CRISPR1-tjp1b Moens Lab ZDB-LAB-990225-6 Chr: 25 2019-09-17
ZDB-ALT-170224-5 fh452Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(isl1-gata2a:GAL4-VP16) ZDB-TGCONSTRCT-170224-4 2019-09-17
ZDB-ALT-170224-10 fh453Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(10XUAS:GFP-vangl2) ZDB-TGCONSTRCT-170224-10 2019-09-17
ZDB-ALT-170822-2 fh454 fh456 Small Deletion embryos treated with CRISPR2-gjd2b mutation is Δ12bp starting in 5'UTR and deleting A of ATG. The nearest ATG is 7bp downstream and would encode a entirely different, frame-shifted, peptide truncating after 53aas Moens Lab ZDB-LAB-990225-6 Chr: 20 2019-09-17
ZDB-ALT-170224-4 fh455Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(shha-gata2a:GAL4-VP16) ZDB-TGCONSTRCT-170224-5 2019-09-17
ZDB-ALT-180920-6 fh463 Small Deletion embryos treated with CRISPR3-tjp1a Moens Lab ZDB-LAB-990225-6 Chr: 7 2019-09-17
ZDB-ALT-180511-5 fh468Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR1-hoxb5a Moens Lab ZDB-LAB-990225-6 Chr: 3 Tg2(hsp70l:GFP) ZDB-TGCONSTRCT-180511-3 2019-09-17
ZDB-ALT-180530-12 fh473 Small Deletion embryos treated with CRISPR Moens Lab ZDB-LAB-990225-6 Unmapped 2019-09-17
ZDB-ALT-180511-4 fh474Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(isl1:EGFP-CAAX) ZDB-TGCONSTRCT-180511-2 2019-09-17
ZDB-ALT-070702-1 fh49 Point Mutation adult males treated with ENU Moens Lab ZDB-LAB-990225-6 Chr: 1 2019-09-17
ZDB-ALT-180416-4 fh506Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(mpeg1.1:Cre) ZDB-TGCONSTRCT-180416-1 2019-09-17
ZDB-ALT-180416-5 fh507Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(mpeg1.1:myd88_L265P) ZDB-TGCONSTRCT-180416-3 2019-09-17
ZDB-ALT-180416-3 fh508Tg Transgenic Insertion embryos treated with DNA Moens Lab ZDB-LAB-990225-6 Unmapped Tg(tnfa:emGFP) ZDB-TGCONSTRCT-180416-2 2019-09-17
ZDB-ALT-180416-2 fh509 Small Deletion embryos treated with CRISPR1-spi1b 10 base pair deletion in exon 4, starting at G124, resulting in a frameshift mutation causing an in-exon stop codon 6 amino acids downstream of the end of the deletion. Moens Lab ZDB-LAB-990225-6 Chr: 7 2019-09-17
ZDB-ALT-190524-1 fh513 Small Deletion embryos treated with CRISPR Moens Lab ZDB-LAB-990225-6 Chr: 14 2019-09-17
ZDB-ALT-110120-2 fh53 Point Mutation ENU The allele (fh53) was never recovered in the screen and all of the data attributed to it in the Johnson et al. (2011) paper was actually data from vc7. Moens Lab ZDB-LAB-990225-6 Unmapped 2019-09-17
ZDB-ALT-111010-4 fhl1b_unrecovered fhl_unrecovered Point Mutation adult males treated with ENU Chr: 10 2019-09-17
ZDB-ALT-180314-9 fi1Tg Transgenic Insertion embryos treated with DNA Vanzi Lab ZDB-LAB-180206-3 Unmapped Tg(elavl3:GCaMP6s) ZDB-TGCONSTRCT-141023-2 2019-09-17
ZDB-ALT-190827-2 fi2Tg Transgenic Insertion embryos treated with DNA Vanzi Lab ZDB-LAB-180206-3 Unmapped Tg(elavl3:H2B-GCaMP6s) ZDB-TGCONSTRCT-190827-1 2019-09-17
ZDB-ALT-080617-2 fk03a Point Mutation The mutant protein is predicted to truncate after the leucine rich repeats but before the coiled-coil domain. The Fishman Laboratory ZDB-LAB-970409-90 Chr: 7 2019-09-17
ZDB-ALT-181214-3 fl10 Small Deletion embryos treated with CRISPR17-rho Fadool Lab ZDB-LAB-050805-1 Chr: 8 2019-09-17
ZDB-ALT-080517-1 fl1Tg Tg(XlRho:EGFP)fl1, XOPS-GFP Transgenic Insertion embryos treated with DNA Fadool Lab ZDB-LAB-050805-1 Unmapped Tg(Xla.Rho:EGFP) ZDB-TGCONSTRCT-080517-1 2019-09-17
ZDB-ALT-170303-1 fl4 Small Deletion embryos treated with TALEN2-six7 mutation is in the SIX domain of Six7
c. 217_229del CAGGTGGCCCGAG, p. (Q11Cfs*39), p. (E10Ifs*50); p. (F7Lfs*44) Fadool Lab ZDB-LAB-050805-1 Chr: 7 2019-09-17
ZDB-ALT-181214-1 fl6 Indel embryos treated with CRISPR17-rho Fadool Lab ZDB-LAB-050805-1 Chr: 8 2019-09-17
ZDB-ALT-181214-2 fl7 Indel embryos treated with CRISPR17-rho Fadool Lab ZDB-LAB-050805-1 Chr: 8 2019-09-17
ZDB-ALT-181214-4 fl8 Indel embryos treated with CRISPR18-rho Fadool Lab ZDB-LAB-050805-1 Chr: 8 2019-09-17
ZDB-ALT-181214-5 fl9 Small Deletion embryos treated with CRISPR18-rho Fadool Lab ZDB-LAB-050805-1 Chr: 8 2019-09-17
ZDB-ALT-101008-6 flt1_unrecovered unrec_flt1, unrecovered_flt1 Point Mutation adult males treated with ENU Chr: 24 2019-09-17
ZDB-ALT-120209-11 fmi10Tg Line 04, Tg(dlx5a-dlx6a:ITETA;PTET:Cr.Cop4-YFP)fmi10 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(dlx5a-dlx6a:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-2 2019-09-17
ZDB-ALT-120209-12 fmi11Tg Tg(-2ompb:Cr.Cop4-YFP)fmi11 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(-2ompb:Cr.Cop4-YFP) ZDB-TGCONSTRCT-120209-4 2019-09-17
ZDB-ALT-120209-2 fmi1Tg Line 01, Tg(elavl3:ITETA;PTET:Cr.Cop4-YFP)fmi1 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(elavl3:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-3 fmi2Tg Line 02, Tg(elavl3:ITETA;PTET:Cr.Cop4-YFP)fmi2 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(elavl3:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-7 fmi3Tg Line 03, Tg(elavl3:ITETA;PTET:Cr.Cop4-YFP)fmi3 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(elavl3:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-4 fmi4Tg Line 04, Tg(elavl3:ITETA;PTET:Cr.Cop4-YFP)fmi4 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(elavl3:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-5 fmi5Tg Line 05, Tg(elavl3:ITETA;PTET:Cr.Cop4-YFP)fmi5 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(elavl3:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-6 fmi6Tg Line 06, Tg(elavl3:ITETA;PTET:Cr.Cop4-YFP)fmi6 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(elavl3:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-1 2019-09-17
ZDB-ALT-120209-8 fmi7Tg Line 01, Tg(dlx5a-dlx6a:ITETA;PTET:Cr.Cop4-YFP)fmi7 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(dlx5a-dlx6a:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-2 2019-09-17
ZDB-ALT-120209-9 fmi8Tg Line 02, Tg(dlx5a-dlx6a:ITETA;PTET:Cr.Cop4-YFP)fmi8 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(dlx5a-dlx6a:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-2 2019-09-17
ZDB-ALT-120209-10 fmi9Tg Line 03, Tg(dlx5a-dlx6a:ITETA;PTET:Cr.Cop4-YFP)fmi9 Transgenic Insertion embryos treated with DNA Friedrich Lab ZDB-LAB-020725-1 Unmapped Tg(PTET:Cr.Cop4-YFP), Tg(dlx5a-dlx6a:ITETA) ZDB-TGCONSTRCT-140429-3, ZDB-TGCONSTRCT-120209-2 2019-09-17
ZDB-ALT-100311-1 fmr1_unrecovered unrec_fmr1, unrecovered_fmr1 Point Mutation adult males treated with ENU Chr: 14 2019-09-17
ZDB-ALT-050711-8 fmv69 mv69 Unknown adult males treated with ENU The Fishman Laboratory ZDB-LAB-970409-90 Chr: 3 2019-09-17
ZDB-ALT-170609-1 fn10a Point Mutation ENU The Fishman Laboratory ZDB-LAB-970409-90 Chr: 3 2019-09-17
ZDB-ALT-100622-2 fo10a Point Mutation MacRae Lab ZDB-LAB-030925-3 Chr: 6 2019-09-17
ZDB-ALT-010621-6 fov01b fov1b Point Mutation The Fishman Laboratory ZDB-LAB-970409-90 Chr: 8 2019-09-17
ZDB-ALT-070330-1 foxh1_unspecified sur, un_foxh1, unspecified_foxh1 Unspecified Chr: 12 2019-09-17
ZDB-ALT-050315-2 foxi1_unspecified un_foxi1, un_nos, unspecified_foxi1 Unspecified Chr: 12 2019-09-17
ZDB-ALT-100311-2 foxp3b_unrecovered unrec_foxp3b, unrecovered_foxp3b Point Mutation adult males treated with ENU Chr: 8 2019-09-17
ZDB-ALT-110111-1 fr100 Point Mutation adult males treated with ENU truncation after Sm2 motif Boehm Lab ZDB-LAB-001129-1 Chr: 4 2019-09-17
ZDB-ALT-101203-1 fr101Tg ikaros:eGFP, Tg(ikzf1:GFP)fr101, Tg(ikzf1:GFP)fr24 Transgenic Insertion embryos treated with DNA Boehm Lab ZDB-LAB-001129-1 Unmapped TgBAC(ikzf1:EGFP) ZDB-TGCONSTRCT-101203-1 2019-09-17
ZDB-ALT-121024-2 fr102Tg TgBAC(ikzf1:tdEosFP)fr102 Transgenic Insertion embryos treated with DNA Boehm Lab ZDB-LAB-001129-1 Unmapped TgBAC(ikzf1:tdEos) ZDB-TGCONSTRCT-121024-2 2019-09-17
ZDB-ALT-121024-1 fr103Tg TgBAC(foxn1:mCherry)fr103 Transgenic Insertion embryos treated with DNA Boehm Lab ZDB-LAB-001129-1 Unmapped TgBAC(foxn1:mCherry) ZDB-TGCONSTRCT-121024-1 2019-09-17
ZDB-ALT-160907-2 fr104Tg Transgenic Insertion embryos treated with DNA 6kb of genomic sequence upstream of the ATG were cloned into pCS2:CFP Boehm Lab ZDB-LAB-001129-1 Unmapped Tg(lck:CFP) ZDB-TGCONSTRCT-160907-2 2019-09-17
ZDB-ALT-070703-2 fr13Tg Tg(hsp70:bmp2b)fr13 Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped Tg(hsp70l:bmp2b) ZDB-TGCONSTRCT-070703-2 2019-09-17
ZDB-ALT-070703-1 fr14Tg Tg(hsp70:nog3)fr14 Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped Tg(hsp70l:nog3) ZDB-TGCONSTRCT-070703-1 2019-09-17
ZDB-ALT-110127-1 fr15 Point Mutation ENU This mutation is an A to C transversion at the second base of the termination codon, resulting in an amino acid change from Stop to Serine and an elongation of the protein by 28 amino acids. This mutation induces a TspRI restriction site which could be used as a restriction fragment length polymorphism (RFLP). fr15 is allelic to fr16. Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 20 2019-09-17
ZDB-ALT-110127-2 fr16 Point Mutation Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 20 2019-09-17
ZDB-ALT-110104-2 fr17 WW20/12 Point Mutation ENU Contains a T > G transversion in exon 13, which changes amino acid 531 from isoleucine to serine. Boehm Lab ZDB-LAB-001129-1 Chr: 3 2019-09-17
ZDB-ALT-181108-8 fr201Tg Transgenic Insertion embryos treated with DNA Trompouki Lab ZDB-LAB-181108-1 Unmapped Tg(UAS:Hsa.HLX,myl7:EGFP) ZDB-TGCONSTRCT-181108-3 2019-09-17
ZDB-ALT-100526-1 fr21 Point Mutation ENU The bdf fr21 allele harboured a 1279T>C mutation in the coding region, leading to a substitution of a serine residue (S427P) that is conserved across many Integrin alpha subunits of multiple species. (adapted from Carney et al. ZDB-PUB-100427-24 ) Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 12 2019-09-17
ZDB-ALT-100526-2 fr22 Point Mutation ENU nel fr22 mutants have a T>A transversion within the coding region, 17 bp upstream of the end of exon 55 (8541T>A). This has a two-fold effect, generating a nonsense mutation Y2847* and converting the genomic sequence from 8538-gtat-8541 sequence to 8538-gtaa-8541, a consensus splice site. As a result, two transcripts (M1 and M2) are generated, M1 spliced at the WT location, and M2 spliced due to the novel splice donor site. In M1 the T>A yields an in-frame nonsense mutation. M2 transcript lacks the last 20 nt of exon 55, creating a frameshift predicted to introduce 10 erroneous amino acids followed by a stop codon. ( adapted from Carney et al. ZDB-PUB-100427-24 ) Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 20 2019-09-17
ZDB-ALT-100526-3 fr23 Point Mutation ENU The rfl fr23 allele of frem1a displayed a 2487T>A mutation leading to a premature stop codon at amino acid position 829 (adapted from Carney et al. ZDB-PUB-100427-24 ) Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 7 2019-09-17
ZDB-ALT-131218-1 fr24 Point Mutation In fr24, a T→A transversion at position 1388 resulted in a nonsense mutation at Leu463.
The highly conserved CUB (Complement C1r/C1s, UEGF, BMP1) and PTX (Pentraxin) protein domains remained intact in the predicted truncated protein, but the GPS motif and 7-transmembrane (7TM) domain were lost. Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 20 2019-09-17
ZDB-ALT-120523-10 fr25 Point Mutation adult males treated with ENU T>A missense mutation: Val223Asp Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 8 2019-09-17
ZDB-ALT-130501-1 fr31Tg TgBAC(avp:KALTA4)fr31 Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped TgBAC(avp:KALTA4) ZDB-TGCONSTRCT-130501-1 2019-09-17
ZDB-ALT-160812-1 fr32Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(krt4:mCherry) ZDB-TGCONSTRCT-160812-1 2019-09-17
ZDB-ALT-140502-1 fr33Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(krt4:Cre-ERT2) ZDB-TGCONSTRCT-140502-1 2019-09-17
ZDB-ALT-140502-2 fr34Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(krtt1c19e:Tomato) ZDB-TGCONSTRCT-140502-2 2019-09-17
ZDB-ALT-140502-3 fr35Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(krtt1c19e:Cre-ERT2) ZDB-TGCONSTRCT-140502-3 2019-09-17
ZDB-ALT-161003-1 fr36Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(krt4:atp1b1a-EGFP) ZDB-TGCONSTRCT-161003-1 2019-09-17
ZDB-ALT-160812-2 fr37Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(hsp70l:Xla.Dvl2) ZDB-TGCONSTRCT-160812-2 2019-09-17
ZDB-ALT-180904-1 fr39Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped TgBAC(pomca:KALTA4) ZDB-TGCONSTRCT-180904-1 2019-09-17
ZDB-ALT-030929-4 fr4 Point Mutation adult males treated with ENU Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 14 2019-09-17
ZDB-ALT-180904-2 fr41Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(pomca:CFP-NTR,myl7:EGFP) ZDB-TGCONSTRCT-180904-2 2019-09-17
ZDB-ALT-180919-2 fr42Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(col2a1a:CFP-NTR) ZDB-TGCONSTRCT-180919-2 2019-09-17
ZDB-ALT-180919-3 fr43Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(col2a1a:EGFP-dnHsa.RARE) ZDB-TGCONSTRCT-180919-3 2019-09-17
ZDB-ALT-180919-4 fr44Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(gsc:Cre) ZDB-TGCONSTRCT-180919-4 2019-09-17
ZDB-ALT-180919-5 fr45Tg Transgenic Insertion embryos treated with DNA Hammerschmidt Lab ZDB-LAB-970507-39 Unmapped Tg(Ola.Actb2:LOXP-AmCyan-LOXP-mCherry) ZDB-TGCONSTRCT-180919-5 2019-09-17
ZDB-ALT-030929-6 fr5 Point Mutation adult males treated with ENU Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 14 2019-09-17
ZDB-ALT-011120-4 fr6 Point Mutation adult males treated with ENU Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 14 2019-09-17
ZDB-ALT-030218-2 fr7 Point Mutation ENU Premature termination at amino acid 501, shortly after the
extracellular cadherin-binding domain 3. Hammerschmidt Lab ZDB-LAB-970507-39 Chr: 20 2019-09-17
ZDB-ALT-180626-1 fri1Tg Transgenic Insertion embryos treated with DNA Jazwinska Lab ZDB-LAB-161208-2 Unmapped Tg(careg:mKOFP2) ZDB-TGCONSTRCT-180626-1 2019-09-17
ZDB-ALT-180626-2 fri2Tg Transgenic Insertion embryos treated with DNA Jazwinska Lab ZDB-LAB-161208-2 Unmapped Tg(careg:Cre-ERT2) ZDB-TGCONSTRCT-180626-2 2019-09-17
ZDB-ALT-190805-1 fri3 del7 Small Deletion embryos treated with CRISPR1-cntf Jazwinska Lab ZDB-LAB-161208-2 Unmapped 2019-09-17
ZDB-ALT-190805-2 fri4 del207 Small Deletion embryos treated with CRISPR1-cntf Jazwinska Lab ZDB-LAB-161208-2 Unmapped 2019-09-17
ZDB-ALT-011017-16 ft09e Point Mutation ENU The Fishman Laboratory ZDB-LAB-970409-90 Chr: 23 2019-09-17
ZDB-ALT-190312-1 fu13Tg Transgenic Insertion embryos treated with DNA Lecaudey Lab ZDB-LAB-091130-1 Unmapped TgBAC(cxcr4b:Hsa.HIST1H2BJ-RFP) ZDB-TGCONSTRCT-190312-1 2019-09-17
ZDB-ALT-160412-1 fu45 Small Deletion embryos treated with TALEN1-amotl2a fu45 has a single-nucleotide deletion in the third exon of amotl2a, resulting in a frame-shift and premature STOP codon. The putative truncated protein product would lack most of the coiled-coil domain and the PDZ-binding domain of the WT protein product. Homozygous mutants were viable, fertile, and generated maternal-zygotic (MZ) mutants that were also morphologically normal, viable, and fertile. Lecaudey Lab ZDB-LAB-091130-1 Chr: 6 2019-09-17
ZDB-ALT-160412-2 fu46 Small Deletion embryos treated with TALEN1-amotl2a fu46 has an eight-nucleotide deletion in the third exon of amotl2a, resulting in a frame-shift and premature STOP codon. The putative truncated protein product would lack most of the coiled-coil domain and the PDZ-binding domain of the WT protein product. Homozygous mutants were viable, fertile, and generated maternal-zygotic (MZ) mutants that were also morphologically normal, viable, and fertile. Lecaudey Lab ZDB-LAB-091130-1 Chr: 6 2019-09-17
ZDB-ALT-160413-3 fu47 Small Deletion embryos treated with TALEN2-yap1 fu47 has a single-nucleotide deletion in yap1, resulting in a frame-shift and premature stop codon in the second exon. The putative truncated protein product would lack most of its functional domains including the Transcriptional Enhancer Activator Domain (TEAD) binding domain, the 2 WW motifs and the PDZ-binding domains. Homozygous mutants were viable and fertile. Lecaudey Lab ZDB-LAB-091130-1 Chr: 18 2019-09-17
ZDB-ALT-160413-4 fu48 Small Deletion embryos treated with TALEN2-yap1 fu48 has a single-nucleotide deletion in yap1, resulting in a frame-shift and premature stop codon in the second exon. The putative truncated protein product would lack most of its functional domains including the Transcriptional Enhancer Activator Domain (TEAD) binding domain, the 2 WW motifs and the PDZ-binding domains. Homozygous mutants were viable and fertile. Lecaudey Lab ZDB-LAB-091130-1 Chr: 18 2019-09-17
ZDB-ALT-190319-5 fu55 Complex embryos treated with TALEN3-wwtr1 This mutant line contains two variants, an insertion of "T" and a deletion of 8 nucleotides.; mutation sequence details
wwtr1 exon 1
------------------------1--------2------3----------------------
wild type GGAGGCTCTTTTT-AACTCGGTCATGAACCCGAAACCGAGCTCCTGGAGGA
fu55 GGAGGCTCTTTTTTAACTCGG--------CCGAAACCGAGCTCCTGGAGGA
1 = 22:38049497 single-nucleotide insertion
2 = 22:38049505 start of deletion (T)
3 = 22:38049512 end of deletion (C) Lecaudey Lab ZDB-LAB-091130-1 Chr: 22 2019-09-17
ZDB-ALT-100811-1 furina_unspecified unspecified_furina Unspecified This record has been created in support of data for which a publication has not specified an allele. Chr: 7 2019-09-17
ZDB-ALT-111010-5 fuz_unrecovered Point Mutation adult males treated with ENU Chr: 2 2019-09-17
ZDB-ALT-081110-1 fv087b Unknown adult males treated with ENU The Fishman Laboratory ZDB-LAB-970409-90 Chr: 13 2019-09-17
ZDB-ALT-010621-2 fv109k Unknown adult males treated with ENU The Fishman Laboratory ZDB-LAB-970409-90 Chr: 8 2019-09-17
ZDB-ALT-041104-2 fw039k fw039-k Point Mutation adult males treated with ENU A point mutation (T to G) in intron 7 creates a novel splice acceptor site, resulting in a 3 amino acid in-frame insertion. The Fishman Laboratory ZDB-LAB-970409-90 Chr: 5 2019-09-17
ZDB-ALT-040312-4 fw07g fw07-g Point Mutation adult males treated with ENU The Fishman Laboratory ZDB-LAB-970409-90 Chr: 6 2019-09-17
ZDB-ALT-050225-2 g1Tg g1, Tg(per3:luc), Tg(per3:luc)g1 Transgenic Insertion DNA Cahill Lab ZDB-LAB-971216-4 Unmapped Tg(per3:Luciferase) ZDB-TGCONSTRCT-070117-112 2019-09-17
ZDB-ALT-100311-3 gata4_unrecovered unrec_gata4, unrecovered_gata4 Point Mutation adult males treated with ENU Chr: 20 2019-09-17
ZDB-ALT-091027-16 gbx1_unrecovered un_gbx1, unrec_gbx1, unrecovered_gbx1 Point Mutation adult males treated with ENU Chr: 24 2019-09-17
ZDB-ALT-091027-17 gbx2_unrecovered un_gbx2, unrec_gbx2, unrecovered_gbx2 Point Mutation adult males treated with ENU Chr: 6 2019-09-17
ZDB-ALT-161102-9 gd10Tg Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Unmapped Tg(ubb:LOXP-BFP-LOXP-jak1_S703I-FLAG,cryaa:Cerulean) ZDB-TGCONSTRCT-161102-7 2019-09-17
ZDB-ALT-161102-10 gd11Tg Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Unmapped Tg(ubb:LOXP-BFP-LOXP-jak1_L910P-FLAG,cryaa:Cerulean) ZDB-TGCONSTRCT-161102-8 2019-09-17
ZDB-ALT-161102-11 gd12Tg Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Unmapped Tg(ubb:LOXP-BFP-LOXP-jak1_L910P-FLAG,cryaa:Cerulean) ZDB-TGCONSTRCT-161102-8 2019-09-17
ZDB-ALT-161102-12 gd13Tg Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Unmapped Tg(ubb:LOXP-BFP-LOXP-jak1_L910P-FLAG,cryaa:Cerulean) ZDB-TGCONSTRCT-161102-8 2019-09-17
ZDB-ALT-161130-1 gd14Tg Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Unmapped Tg(zp3b:zar1,myl7:EGFP) ZDB-TGCONSTRCT-161130-1 2019-09-17
ZDB-ALT-161201-1 gd15Gt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA The Tol2 transposon element is inserted into the first intron of lkb1 gene, which is predicted to produce a fused transcript containing the first exon of lkb1 and the EGFP coding sequence. As the translation start codon of lkb1 resides in the second exon, the fusion transcript should be translated into only EGFP protein. Jian Zhang Laboratory ZDB-LAB-120411-1 Chr: 2 Gt2(bcl2a-EGFP) ZDB-GTCONSTRCT-120412-2 2019-09-17
ZDB-ALT-120412-2 gd1Gt This feature is representative of one or more unknown insertion sites. Gt(T2ASA)gd1, short lightning, slg Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Chr: 24 Gt2(bcl2a-EGFP) ZDB-GTCONSTRCT-120412-2 2019-09-17
ZDB-ALT-131120-1 gd2Gt This feature is representative of one or more unknown insertion sites. Gt(T2ASA)gd2, lapse Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Chr: 13 Gt2(bcl2a-EGFP) ZDB-GTCONSTRCT-120412-2 2019-09-17
ZDB-ALT-160805-2 gd3 Small Deletion embryos treated with CRISPR1-vclb Jian Zhang Laboratory ZDB-LAB-120411-1 Chr: 12 2019-09-17
ZDB-ALT-160805-3 gd4Gt This feature is representative of one or more unknown insertion sites. v12 Transgenic Insertion embryos treated with DNA the transposon insertion causes fusion of EGFP with the N-terminal 261 amino acids of Vclb (in the head domain of the protein) Jian Zhang Laboratory ZDB-LAB-120411-1 Chr: 12 Gt(vclb:vclb-EGFP) ZDB-GTCONSTRCT-160805-1 2019-09-17
ZDB-ALT-161121-6 gd5 Small Deletion embryos treated with TALEN1-zar1 Jian Zhang Laboratory ZDB-LAB-120411-1 Chr: 20 2019-09-17
ZDB-ALT-161121-7 gd6 Indel embryos treated with CRISPR1-zar1 Jian Zhang Laboratory ZDB-LAB-120411-1 Chr: 20 2019-09-17
ZDB-ALT-161102-6 gd7Tg Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Unmapped Tg(ubb:LOXP-BFP-LOXP-kras_G12V) ZDB-TGCONSTRCT-161102-6 2019-09-17
ZDB-ALT-161102-7 gd8Tg Transgenic Insertion embryos treated with DNA Jian Zhang Laboratory ZDB-LAB-120411-1 Unmapped Tg(ubb:LOXP-BFP-LOXP-jak1_S703I-FLAG,cryaa:Cerulean) ZDB-TGCONSTRCT-161102-7 2019-09-17
ZDB-ALT-161102-8 gd9Tg Transgenic Insertion Jian Zhang Laboratory ZDB-LAB-120411-1 Unmapped Tg(ubb:LOXP-BFP-LOXP-jak1_S703I-FLAG,cryaa:Cerulean) ZDB-TGCONSTRCT-161102-7 2019-09-17
ZDB-ALT-151209-1 ge2Tg Transgenic Insertion embryos treated with DNA Dosch Lab ZDB-LAB-040220-1 Unmapped Tg(buc:buc-EGFP) ZDB-TGCONSTRCT-151209-1 2019-09-17
ZDB-ALT-150707-5 gi1 Indel embryos treated with TALEN1-tbx4 homozygous viable Hesselson Lab ZDB-LAB-150630-1 Chr: 15 2019-09-17
ZDB-ALT-170815-4 gi2 Small Deletion embryos treated with TALEN1-pink1 Hesselson Lab ZDB-LAB-150630-1 Chr: 23 2019-09-17
ZDB-ALT-180605-4 gi3Tg Transgenic Insertion embryos treated with DNA Hesselson Lab ZDB-LAB-150630-1 Unmapped Tg(ins:Luciferase,cryaa:mCherry) ZDB-TGCONSTRCT-180605-3 2019-09-17
ZDB-ALT-190313-1 gi5Tg Transgenic Insertion Transplantation Immunology ZDB-LAB-190220-1 Unmapped 2019-09-17
ZDB-ALT-170222-1 gib003Tg Transgenic Insertion embryos treated with DNA Sivasubbu Lab ZDB-LAB-120608-2 Unmapped Tg2(myl7:mRFP) ZDB-TGCONSTRCT-170222-1 2019-09-17
ZDB-ALT-180724-2 gib1001Tg Transgenic Insertion embryos treated with DNA Sachidanandan Lab ZDB-LAB-100625-1 Unmapped Tg(fabp10a:GAL4-VP16,myl7:Cerulean) ZDB-TGCONSTRCT-180724-2 2019-09-17
ZDB-ALT-180724-1 gib1002Tg Transgenic Insertion embryos treated with DNA Sachidanandan Lab ZDB-LAB-100625-1 Unmapped Tg(Xla.Eef1a:GAL4-VP16,myl7:Cerulean) ZDB-TGCONSTRCT-180724-1 2019-09-17
ZDB-ALT-190314-2 gib2001Tg Transgenic Insertion embryos treated with DNA Pillai Lab ZDB-LAB-131121-3 Unmapped Tg(her4.1:mCherry) ZDB-TGCONSTRCT-190314-1 2019-09-17
ZDB-ALT-050426-2 gja5b_unspecified cx41.8_unspecified, un_cx41.8, un_leo, unspecified_cx41.8 Unspecified Chr: 1 2019-09-17
ZDB-ALT-101008-5 gjd2b_unrecovered cx35b_unrecovered, cx35_unrecovered, unrec_cx35, unrecovered_cx35 Point Mutation adult males treated with ENU Chr: 20 2019-09-17
ZDB-ALT-130925-7 gl1 Point Mutation adult males treated with ENU gl1 has a G to T transversion in exon 8 which results in E396Stop. Lieschke Laboratory ZDB-LAB-970418-14 Chr: 15 2019-09-17
ZDB-ALT-070117-7 gl10 syr, syrah Point Mutation adult males treated with ENU T>A transversion resulting in a V1046D amino acid change in Med12. Lieschke Laboratory ZDB-LAB-970418-14 Chr: 14 2019-09-17
ZDB-ALT-070117-14 gl11 gl12, mne Point Mutation ENU Lieschke Laboratory ZDB-LAB-970418-14 Chr: 6 2019-09-17
ZDB-ALT-170531-3 gl12 Complex embryos treated with CRISPR1-zbtb11 3 point mutations:
1) T>G at position 29159643, Chromosome 6 (GRCz11)
2) C>A at position 29159654, Chromosome 6 (GRCz11)
3) C>G at position 29159663, Chromosome 6 (GRCz11) Lieschke Laboratory ZDB-LAB-970418-14 Chr: 6 2019-09-17
ZDB-ALT-070117-27 gl13 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-8 gl14 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-15 gl15 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-28 gl16 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-9 gl17 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-16 gl19 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-060403-2 gl2 Point Mutation adult males treated with ENU Lieschke Laboratory ZDB-LAB-970418-14 Chr: 2 2019-09-17
ZDB-ALT-070117-10 gl20 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-060715-2 gl21Tg gl21, Tg(-5.3spi1:EGFP), Tg(-5.3spi1:EGFP)gl21 Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(-5.3spi1b:EGFP) ZDB-TGCONSTRCT-070117-70 2019-09-17
ZDB-ALT-120117-1 gl22Tg Tg(mpeg1:EGFP)gl22 Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(mpeg1:EGFP) ZDB-TGCONSTRCT-120117-1 2019-09-17
ZDB-ALT-120117-2 gl23Tg Tg(mpeg1:mCherry)gl23 Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(mpeg1:mCherry) ZDB-TGCONSTRCT-120117-2 2019-09-17
ZDB-ALT-120117-3 gl24Tg Tg(mpeg1:Gal4-VP16)gl24 Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(mpeg1:GAL4-VP16) ZDB-TGCONSTRCT-120117-3 2019-09-17
ZDB-ALT-130122-2 gl25Tg Tg(mpeg1:Gal4FF)gl25 Transgenic Insertion DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(mpeg1.1:GAL4FF) ZDB-TGCONSTRCT-130122-1 2019-09-17
ZDB-ALT-130128-8 gl26Tg Tg(mpeg1:mCherryCAAX)gl26 Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(mpeg1:mCherry-CAAX) ZDB-TGCONSTRCT-130128-5 2019-09-17
ZDB-ALT-130128-9 gl27Tg Tg(-8mpx:EGFPCAAX)gl27 Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(-8mpx:EGFP-CAAX) ZDB-TGCONSTRCT-130128-6 2019-09-17
ZDB-ALT-151201-1 gl28Tg Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(-8mpx:KALTA4) ZDB-TGCONSTRCT-151201-3 2019-09-17
ZDB-ALT-151201-2 gl29Tg Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(-8mpx:H2B-Cerulean-2A-mKOFP2-CAAX) ZDB-TGCONSTRCT-151201-4 2019-09-17
ZDB-ALT-160427-3 gl30Tg Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(-8mpx:mCherry-CAAX) ZDB-TGCONSTRCT-160427-3 2019-09-17
ZDB-ALT-161104-2 gl31 Small Deletion embryos treated with CRISPR3-csf3r Lieschke Laboratory ZDB-LAB-970418-14 Chr: 16 2019-09-17
ZDB-ALT-161104-3 gl32 Indel embryos treated with CRISPR3-csf3r Lieschke Laboratory ZDB-LAB-970418-14 Chr: 16 2019-09-17
ZDB-ALT-161104-4 gl33 Small Deletion embryos treated with CRISPR3-csf3r Lieschke Laboratory ZDB-LAB-970418-14 Ambiguous 2019-09-17
ZDB-ALT-161104-5 gl34 Small Deletion embryos treated with CRISPR3-csf3r Lieschke Laboratory ZDB-LAB-970418-14 Chr: 16 2019-09-17
ZDB-ALT-161111-3 gl35 Insertion embryos treated with CRISPR3-smarcd2 Lieschke Laboratory ZDB-LAB-970418-14 Chr: 12 2019-09-17
ZDB-ALT-190620-1 gl36Tg Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(4xUAS:NLS-Cas9,cryaa:EGFP) ZDB-TGCONSTRCT-190620-1 2019-09-17
ZDB-ALT-190620-2 gl37Tg Transgenic Insertion embryos treated with DNA Lieschke Laboratory ZDB-LAB-970418-14 Unmapped Tg(4xUAS:NLS-Cas9,myl7:RFP) ZDB-TGCONSTRCT-190620-2 2019-09-17
ZDB-ALT-190620-3 gl38Tg Transgenic Insertion Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-190620-4 gl39 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-29 gl4 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-190620-5 gl40 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-190620-6 gl41 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-190620-7 gl42Tg Transgenic Insertion Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-11 gl5 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-17 gl6 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-30 gl7 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Unmapped 2019-09-17
ZDB-ALT-070117-12 gl8 Point Mutation Lieschke Laboratory ZDB-LAB-970418-14 Chr: 10 2019-09-17
ZDB-ALT-070117-18 gl9 Unknown Lieschke Laboratory ZDB-LAB-970418-14 Chr: 14 2019-09-17
ZDB-ALT-081031-1 gli1_unspecified un_gli1, unspecified_gli1 Unspecified Chr: 6 2019-09-17
ZDB-ALT-081031-2 gli2a_unspecified un_gli2a, unspecified_gli2a Unspecified Chr: 9 2019-09-17
ZDB-ALT-110520-4 gmc1Tg GnRH3:EMD, Tg(-6gnrh3:emGFP)gmc1 Transgenic Insertion embryos treated with DNA Kozlowski Lab ZDB-LAB-011113-1 Unmapped Tg(-6gnrh3:emGFP) ZDB-TGCONSTRCT-110520-3 2019-09-17
ZDB-ALT-120217-3 gmc500Tg Tg(rho:YFP-Eco.NfsB)gmc500 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Tg(rho:YFP-NTR) ZDB-TGCONSTRCT-120217-1 2019-09-17
ZDB-ALT-130611-1 gmc601Et Et(2xNRSE-Mmu.Fos:KalTA4)gmc601, Et(NSRE-fos:KalTA4)gmc601 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130611-3 gmc603Et Et(2xNRSE-Mmu.Fos:KalTA4)gmc603, Et(NSRE-fos:KalTA4)gmc603 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130611-4 gmc604Et Et(2xNRSE-Mmu.Fos:KalTA4)gmc604, Et(NSRE-fos:KalTA4)gmc604 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130611-5 gmc605Et Et(2xNRSE-Mmu.Fos:KalTA4)gmc605, Et(NSRE-fos:KalTA4)gmc605 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-121108-1 gmc606Et Et(NRSE-cfos:KalTA4), Et(NSRE-fos:KalTA4)gmc606, Et(RE1-fos:KalTA4)gmc606, NRCKgmc606 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-121108-2 gmc607Et Et(NRSE-cfos:KalTA4), Et(NSRE-fos:KalTA4)gmc607, Et(RE1-fos:KalTA4)gmc607, NRCKgmc607 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130611-6 gmc608Et Et(2xNRSE-Mmu.Fos:KalTA4)gmc608, Et(NSRE-fos:KalTA4)gmc608 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130611-2 gmc617Et Et(2xNRSE-Mmu.Fos:KalTA4)gmc617, Et(NSRE-fos:KalTA4)gmc617 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130613-12 gmc618Et Et(2xNRSE-Mmu.fos:KalTA4)gmc618 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130613-13 gmc621Et Et(2xNRSE-Mmu.fos:KalTA4)gmc621 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130613-14 gmc623Et Et(2xNRSE-Mmu.fos:KalTA4)gmc623 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130613-15 gmc624Et Et(2xNRSE-Mmu.fos:KalTA4)gmc624 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130613-16 gmc631Et Et(2xNRSE-Mmu.fos:KalTA4)gmc631 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-121108-3 gmc632Et Et(NRSE-cfos:KalTA4), Et(NSRE-fos:KalTA4)gmc632, Et(RE1-fos:KalTA4)gmc632, NRCKgmc632 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-121108-4 gmc641Et Et(NRSE-cfos:KalTA4), Et(NSRE-fos:KalTA4)gmc641, Et(RE1-fos:KalTA4)gmc641, NRCKgmc641 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130613-2 gmc642Et Et(2xNRSE-Mmu.fos:KalTA4)gmc642 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.fos:KALTA4) ZDB-ETCONSTRCT-121107-1 2019-09-17
ZDB-ALT-130613-17 gmc675Et Et(Mmu.Fos:KalTA4)gmc675 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(Mmu.Fos:KALTA4) ZDB-ETCONSTRCT-130611-1 2019-09-17
ZDB-ALT-130613-18 gmc678Et Et(Mmu.Fos:KalTA4)gmc678 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(Mmu.Fos:KALTA4) ZDB-ETCONSTRCT-130611-1 2019-09-17
ZDB-ALT-130613-19 gmc679Et Et(Mmu.Fos:KalTA4)gmc679 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(Mmu.Fos:KALTA4) ZDB-ETCONSTRCT-130611-1 2019-09-17
ZDB-ALT-130613-24 gmc680Et Et(Mmu.Fos:KalTA4)gmc680 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(Mmu.Fos:KALTA4) ZDB-ETCONSTRCT-130611-1 2019-09-17
ZDB-ALT-130613-20 gmc691Et Et(Mmu.Fos:KalTA4)gmc691 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(Mmu.Fos:KALTA4) ZDB-ETCONSTRCT-130611-1 2019-09-17
ZDB-ALT-130613-21 gmc693Et Et(Mmu.Fos:KalTA4)gmc693 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(Mmu.Fos:KALTA4) ZDB-ETCONSTRCT-130611-1 2019-09-17
ZDB-ALT-130613-1 gmc694Et Et(Mmu.Fos:KalTA4)gmc694 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(Mmu.Fos:KALTA4) ZDB-ETCONSTRCT-130611-1 2019-09-17
ZDB-ALT-130613-22 gmc697Et Et(Mmu.Fos:KalTA4)gmc697 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(Mmu.Fos:KALTA4) ZDB-ETCONSTRCT-130611-1 2019-09-17
ZDB-ALT-120220-1 gmc700Et Et(fos:KalTA4,5xUAS:Eco.NfsB,14xUAS:gap43-YFP)gmc700 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(fos:KALTA4,5xUAS:NTR,14xUAS:GAP-YFP) ZDB-ETCONSTRCT-120217-2 2019-09-17
ZDB-ALT-120217-2 gmc701Et Et(fos:KalTA4,5xUAS:Eco.NfsB,14xUAS:gap43-YFP)gmc701 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(fos:KALTA4,5xUAS:NTR,14xUAS:GAP-YFP) ZDB-ETCONSTRCT-120217-2 2019-09-17
ZDB-ALT-130613-3 gmc739Et Et(2xNRSE-Mmu.Fos:KalTA4,LOXP-5xUAS-ADV.E1b:GAP-YFP-LOXP)gmc739 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Et(2xNRSE-Mmu.Fos:KALTA4,LOXP-5xUAS-E1B:GAP-YFP-LOXP) ZDB-ETCONSTRCT-130611-3 2019-09-17
ZDB-ALT-130613-6 gmc830Tg Tg(LOXP-5xUAS-ADV.E1b:GAP-YFP-LOXP,he1a:GAP-YFP)gmc830 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Tg(LOXP-5xUAS-E1B:GAP-YFP-LOXP,he1.1:GAP-YFP) ZDB-TGCONSTRCT-130611-3 2019-09-17
ZDB-ALT-130613-26 gmc835Tg Tg(LOXP-5xUAS-ADV.E1b:GAP-YFP-LOXP,he1a:GAP-YFP)gmc835 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Tg(LOXP-5xUAS-E1B:GAP-YFP-LOXP,he1.1:GAP-YFP) ZDB-TGCONSTRCT-130611-3 2019-09-17
ZDB-ALT-130613-4 gmc930Tg Tg(LOXP-5xUAS-ADV.E1b:GAP-YFP-LOXP,he1a:GAP-YFP)gmc930 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Tg(LOXP-5xUAS-E1B:GAP-YFP-LOXP,he1.1:GAP-YFP) ZDB-TGCONSTRCT-130611-3 2019-09-17
ZDB-ALT-130613-25 gmc932Tg Tg(2xNRSE-LOXP-5xUAS-ADV.E1b:GAP-YFP-LOXP,he1a:GAP-YFP)gmc932 Transgenic Insertion embryos treated with DNA Mumm Lab ZDB-LAB-090729-1 Unmapped Tg(2xNRSE-LOXP-5xUAS-E1B:GAP-YFP-LOXP,he1.1:GAP-YFP) ZDB-TGCONSTRCT-130611-4 2019-09-17
ZDB-ALT-160617-1 gmu1Tg Transgenic Insertion embryos treated with DNA Zhi-Xu He Lab ZDB-LAB-160616-1 Unmapped Tg2(lmo2:LOXP-DsRed-LOXP-EGFP) ZDB-TGCONSTRCT-160617-1 2019-09-17
ZDB-ALT-160617-2 gmu2Tg Transgenic Insertion embryos treated with DNA Zhi-Xu He Lab ZDB-LAB-160616-1 Unmapped Tg(lmo2:LOXP-DsRed-LOXP-hoxb4a-EGFP) ZDB-TGCONSTRCT-160617-2 2019-09-17
ZDB-ALT-050209-42 gpc4_unspecified un_gpc4, un_kny, unspecified_gpc4 Unspecified Chr: 14 2019-09-17
ZDB-ALT-150804-1 gt1Tg Transgenic Insertion embryos treated with DNA Chong Shin lab ZDB-LAB-110223-1 Unmapped Tg2(fabp10a:CFP-NTR) ZDB-TGCONSTRCT-150804-1 2019-09-17
ZDB-ALT-150804-2 gt2Tg Transgenic Insertion embryos treated with DNA Chong Shin lab ZDB-LAB-110223-1 Unmapped Tg(fabp10a:mCherry-NTR) ZDB-TGCONSTRCT-150804-2 2019-09-17
ZDB-ALT-160413-7 gt3Tg Transgenic Insertion embryos treated with DNA Chong Shin lab ZDB-LAB-110223-1 Unmapped Tg(HSE:fhl1b,GFP) ZDB-TGCONSTRCT-160413-3 2019-09-17
ZDB-ALT-190204-4 gt4Tg Transgenic Insertion embryos treated with DNA Chong Shin lab ZDB-LAB-110223-1 Unmapped Tg(HSE:pde3a,HSE:GFP) ZDB-TGCONSTRCT-190204-1 2019-09-17
ZDB-ALT-130214-10 gu10Tg Tg(oxt.2:EGFP)gu10 Transgenic Insertion embryos treated with DNA Glasgow Lab ZDB-LAB-010524-1 Unmapped Tg2(oxt:EGFP) ZDB-TGCONSTRCT-130214-2 2019-09-17
ZDB-ALT-130214-11 gu15Tg Tg(oxt.3:EGFP)gu15 Transgenic Insertion embryos treated with DNA Glasgow Lab ZDB-LAB-010524-1 Unmapped Tg3(oxt:EGFP) ZDB-TGCONSTRCT-130214-3 2019-09-17
ZDB-ALT-130214-8 gu1Tg Tg(oxt.2:EGFP)gu1 Transgenic Insertion embryos treated with DNA Glasgow Lab ZDB-LAB-010524-1 Unmapped Tg2(oxt:EGFP) ZDB-TGCONSTRCT-130214-2 2019-09-17
ZDB-ALT-130214-9 gu9Tg Tg(oxt.2:EGFP)gu9 Transgenic Insertion embryos treated with DNA Glasgow Lab ZDB-LAB-010524-1 Unmapped Tg2(oxt:EGFP) ZDB-TGCONSTRCT-130214-2 2019-09-17
ZDB-ALT-070809-2 gw1 Point Mutation Gitlin Lab ZDB-LAB-040813-3 Chr: 22 2019-09-17
ZDB-ALT-080825-1 gw325 catastrophe Point Mutation adult males treated with ENU This is a C to T point mutation resulting in a premature stop codon, Q136X. Homozygous lethal at 3 dpf. Gitlin Lab ZDB-LAB-040813-1 Chr: 7 2019-09-17
ZDB-ALT-150325-5 gw326 skolios Point Mutation sperm treated with ENU Buchan et al (2014): nonsense mutation, caused by a G>T transversion at chr17:48958292 (Zv9) in the second exon of kif6 (encoding kinesin family member 6). The kif6gw326 mutant allele, corresponding to a C>A base change at position 205 in the kif6 mRNA (NM_001077431, kif6 is encoded on the minus strand), is predicted to truncate kif6 in the kinesin motor domain (Tyr53X) Goldsmith Lab ZDB-LAB-040810-2 Chr: 17 2019-09-17
ZDB-ALT-150325-6 gw327 Small Deletion embryos treated with TALEN1-kif6 Buchan et al (2014): 8bp deletion in exon2 of kif6 Goldsmith Lab ZDB-LAB-040810-2 Chr: 17 2019-09-17
ZDB-ALT-150325-7 gw328 Small Deletion embryos treated with TALEN1-kif6 Buchan et al (2014): 8bp deletion in exon2 of kif6 Goldsmith Lab ZDB-LAB-040810-2 Chr: 17 2019-09-17
ZDB-ALT-150325-8 gw329 Small Deletion embryos treated with TALEN1-kif6 Buchan et al (2014): 4bp deletion in exon2 of kif6 Goldsmith Lab ZDB-LAB-040810-2 Chr: 17 2019-09-17
ZDB-ALT-090212-1 gw71 Point Mutation adult males treated with ENU Change from T to G results in the amino acid substitution I1061S. Homozygous viable. Gitlin Lab ZDB-LAB-040813-3 Chr: 14 2019-09-17
ZDB-ALT-160209-2 gy1Tg Transgenic Insertion embryos treated with DNA Bally-Cuif Lab ZDB-LAB-990226-15 Unmapped Tg(-3.2-fev:GAL4-GFP) ZDB-TGCONSTRCT-160209-2 2019-09-17
ZDB-ALT-160126-1 gy2Tg Transgenic Insertion embryos treated with DNA Bally-Cuif Lab ZDB-LAB-990226-15 Unmapped Tg(mcm5:EGFP) ZDB-TGCONSTRCT-160126-1 2019-09-17
ZDB-ALT-170120-1 gy3Tg Transgenic Insertion embryos treated with DNA Bally-Cuif Lab ZDB-LAB-990226-15 Unmapped TgBAC(her5:NLS-mCherry,myl7:EGFP) ZDB-TGCONSTRCT-170120-1 2019-09-17
ZDB-ALT-170120-2 gy4Tg Transgenic Insertion embryos treated with DNA Bally-Cuif Lab ZDB-LAB-990226-15 Unmapped TgBAC(her5:ERT2-Cre-ERT2) ZDB-TGCONSTRCT-170120-2 2019-09-17
ZDB-ALT-190712-3 gyf1 Small Deletion embryos treated with CRISPR1-pi4kb 1bp of "G" deletion from position 988bp exon2 of wild-type pi4kb coding sequence Development and functional regulation of BBB ZDB-LAB-170208-8 Unmapped 2019-09-17
ZDB-ALT-190712-4 gyf2 Small Deletion embryos treated with CRISPR1-pi4kb 5bp of "GAGAA" deletion from position 988bp exon2 of wild-type pi4kb coding sequence Development and functional regulation of BBB ZDB-LAB-170208-8 Unmapped 2019-09-17
ZDB-ALT-080207-4 gz10Tg Tg(mylz2:YFP)gz10 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(mylpfa:YFP) ZDB-TGCONSTRCT-080207-3 2019-09-17
ZDB-ALT-080619-1 gz11Tg Tg(hspb1:EGFP)gz11 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(hspb1:EGFP) ZDB-TGCONSTRCT-080619-1 2019-09-17
ZDB-ALT-090312-1 gz13Tg Tg(krt4:GFP;mylz2:RFP)gz13 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg2(krt4:GFP), Tg2(mylpfa:RFP) ZDB-TGCONSTRCT-090312-1, ZDB-TGCONSTRCT-140429-7 2019-09-17
ZDB-ALT-090316-1 gz14Tg Tg(zp3:Cre;krt4:loxp-EGFP-loxp-RFP)gz14 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(krt4:LOXP-EGFP-LOXP-RFP), Tg(zp3:Cre) ZDB-TGCONSTRCT-140429-2, ZDB-TGCONSTRCT-090312-2 2019-09-17
ZDB-ALT-090424-3 gz15Tg LiPan, Tg(fabp10:RFP,ela3l:EGFP)gz12, Tg(fabp1a:dsRed;ela3l:EGFP)gz15, Tg(fabp1a:dsRed;ela3l:GFP)gz15, Tg(lfabp1a:dsRed;ela3l:GFP)gz15, Tg(lfabp:RFP,elaA:EGFP)gz12 Transgenic Insertion embryos treated with DNA Homozygous LiPan zebrafish were viable and had no visible phenotype. The LiPan line has been maintained in our laboratories for over eight generations and co-expression of RFP in the liver and GFP in the exocrine pancreas is always observed. Thus the two injected DNA constructs are likely co-integrated into the same chromosomal locus Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(ela3l:EGFP), Tg(fabp10a:DsRed) ZDB-TGCONSTRCT-070117-92, ZDB-TGCONSTRCT-140326-1 2019-09-17
ZDB-ALT-140326-1 gz15aTg Transgenic Insertion embryos treated with DNA This line was generated by removing the green pancrease reporter (EGFP) from the Tg(fabp10a:DsRed,ela3l:EGFP)gz15 line. Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:DsRed) ZDB-TGCONSTRCT-140326-1 2019-09-17
ZDB-ALT-110203-3 gz16Tg Tg(fabp10a:Gal4)gz16 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:GAL4) ZDB-TGCONSTRCT-110203-3 2019-09-17
ZDB-ALT-110203-4 gz17Tg Tg(UAS:WDSV.rv-cyclin)gz17 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(UAS:WDSV.rv-cyclin) ZDB-TGCONSTRCT-110203-4 2019-09-17
ZDB-ALT-110207-1 gz18Tg Tg(sst2:GFP)gz18 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(sst2:GFP) ZDB-TGCONSTRCT-110204-5 2019-09-17
ZDB-ALT-110207-2 gz19Tg Tg(sst2:RFP)gz19 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(sst2:RFP) ZDB-TGCONSTRCT-110207-1 2019-09-17
ZDB-ALT-060830-6 gz1Tg gz1, Tg(-3.8zp3.2:EGFP), Tg(-3.8zp3.2:EGFP)gz1 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(-3.8zp3.2:EGFP) ZDB-TGCONSTRCT-070117-10 2019-09-17
ZDB-ALT-110217-1 gz20Tg Tg(5xUAS.2:EGFP)gz20 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg2(5xUAS:EGFP) ZDB-TGCONSTRCT-110217-1 2019-09-17
ZDB-ALT-120104-1 gz21Tg Tg(fabp10a:EGFP-kras_G12V)gz21 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:EGFP-kras_G12V) ZDB-TGCONSTRCT-120104-1 2019-09-17
ZDB-ALT-120710-1 gz22Tg Tg(fabp10a:EGFP-map1lc3b)gz22 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:EGFP-map1lc3b) ZDB-TGCONSTRCT-120710-1 2019-09-17
ZDB-ALT-120823-1 gz23Tg Tg(fabp10a:LEXPR,LEXOP:EGFP)gz23 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:LEXPR,LEXOP:EGFP) ZDB-TGCONSTRCT-120823-1 2019-09-17
ZDB-ALT-120823-2 gz24Tg Tg(crybb1:mCherry,LEXOP:EGFP-kras_G12V)gz24 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(crybb1:mCherry,LEXOP:EGFP-kras_G12V) ZDB-TGCONSTRCT-120823-2 2019-09-17
ZDB-ALT-120926-4 gz25Tg Tg(fabp10a:rtTA;TETRE:Xhe.Xmrk2;krt4:GFP)gz25, Tg(fabp10a:rtTA;TETRE:Xxi.Xmrk2;krt4:GFP)gz25, Tg(fabp10a:TA;TETRE:Xhe.Xmrk2;krt4:GFP)gz25 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(TETRE:Xxi.Xmrk2), Tg(fabp10a:RTTA), Tg(krt4:GFP) ZDB-TGCONSTRCT-140429-6, ZDB-TGCONSTRCT-120926-4, ZDB-TGCONSTRCT-080207-1 2019-09-17
ZDB-ALT-121218-1 gz26Tg Tg(fabp10a:RTTA;TETRE:Mmu.Myc;krt4:GFP)gz26 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(TETRE:Mmu.Myc), Tg(fabp10a:RTTA), Tg(krt4:GFP) ZDB-TGCONSTRCT-121218-1, ZDB-TGCONSTRCT-120926-4, ZDB-TGCONSTRCT-080207-1 2019-09-17
ZDB-ALT-150417-1 gz27Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(crybb1:mCherry,LEXOP:EGFP-myca) ZDB-TGCONSTRCT-150417-1 2019-09-17
ZDB-ALT-150417-2 gz28Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(crybb1:mCherry,LEXOP:EGFP-mycb) ZDB-TGCONSTRCT-150417-2 2019-09-17
ZDB-ALT-151022-4 gz29Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:RTTA,TETRE:mCherry-rhoab) ZDB-TGCONSTRCT-151022-1 2019-09-17
ZDB-ALT-060710-10 gz2Tg Tg(ela2al:GFP)unspecified, Tg(ela3l:GFP), Tg(ela3l:GFP)gz2, Tg(ela3l:GFP)unspecified, Tg(elastase:GFP) Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(ela3l:EGFP) ZDB-TGCONSTRCT-070117-92 2019-09-17
ZDB-ALT-151022-3 gz30Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:RTTA,TETRE:mCherry-carhoab_G14V) ZDB-TGCONSTRCT-151022-2 2019-09-17
ZDB-ALT-151022-2 gz31Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:RTTA,TETRE:mCherry-dnrhoab_T19N) ZDB-TGCONSTRCT-151022-3 2019-09-17
ZDB-ALT-151022-1 gz32Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(TETRE:EGFP-kras_G12V), Tg(fabp10a:RTTA) ZDB-TGCONSTRCT-151022-4, ZDB-TGCONSTRCT-120926-4 2019-09-17
ZDB-ALT-160204-1 gz33Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(Ola.Cyp1a:GFP) ZDB-TGCONSTRCT-160204-1 2019-09-17
ZDB-ALT-160413-1 gz34Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(crybb1:mCherry,LEXOP:NLS-Cre) ZDB-TGCONSTRCT-160413-1 2019-09-17
ZDB-ALT-160413-2 gz35Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:LOXP-mCherry-LOXP-EGFP-kras_G12V) ZDB-TGCONSTRCT-160413-2 2019-09-17
ZDB-ALT-180404-4 gz36Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:LEXPR-2A-mCherry-LEXOP-tgfb1a) ZDB-TGCONSTRCT-180404-2 2019-09-17
ZDB-ALT-190404-1 gz37Tg Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp2:LEXPR,LEXOP:EGFP-krasG12V) ZDB-TGCONSTRCT-190404-1 2019-09-17
ZDB-ALT-051227-8 gz3Tg gz3, Tg(mylz2:loxP-EGFP-loxP), Tg(mylz2:loxP-EGFP-loxP)gz3, Tg(mylz2:loxP-EGFP-loxP)unspecified Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(mylpfa:LOXP-EGFP-LOXP) ZDB-TGCONSTRCT-070117-166 2019-09-17
ZDB-ALT-080109-1 gz4Tg Tg(fabp10:dsRed)gz4, Tg(fabp1a:dsRed)gz4 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(fabp10a:DsRed) ZDB-TGCONSTRCT-140326-1 2019-09-17
ZDB-ALT-071016-1 gz5Tg line A, sq3, Tg(mylz2:GFP)gz5, Tg(mylz2:GFP)sq3 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(mylpfa:GFP) ZDB-TGCONSTRCT-071016-1 2019-09-17
ZDB-ALT-071016-2 gz6Tg line B, sq4, Tg(mylz2:GFP)gz6, Tg(mylz2:GFP)sq4 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(mylpfa:GFP) ZDB-TGCONSTRCT-071016-1 2019-09-17
ZDB-ALT-080207-1 gz7Tg Tg(krt8:GFP)gz7 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(krt4:GFP) ZDB-TGCONSTRCT-080207-1 2019-09-17
ZDB-ALT-080207-2 gz8Tg Tg(mylz2:GFP)gz8 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(mylpfa:GFP) ZDB-TGCONSTRCT-071016-1 2019-09-17
ZDB-ALT-080207-3 gz9Tg Tg(mylz2:rfp)gz9 Transgenic Insertion embryos treated with DNA Zhiyuan Gong Lab ZDB-LAB-970507-9 Unmapped Tg(mylpfa:RFP) ZDB-TGCONSTRCT-080207-2 2019-09-17
ZDB-ALT-080714-1 ha01Tg Tg(-5.0sox17:EGFP)ha01, Tg(-5.0sox17:EGFP)zf99, Tg(sox17:EGFP)zf99, zf99 Transgenic Insertion DNA Kikuchi Lab ZDB-LAB-020408-3 Unmapped Tg(-5.0sox17:EGFP) ZDB-TGCONSTRCT-080714-1 2019-09-17
ZDB-ALT-180917-2 ha11 Small Deletion embryos treated with TALEN1-hey1 Kikuchi Lab ZDB-LAB-020408-3 Chr: 19 2019-09-17
ZDB-ALT-121012-1 ha2 Point Mutation adult males treated with ENU Kikuchi Lab ZDB-LAB-020408-3 Chr: 8 2019-09-17
ZDB-ALT-120404-4 ha4 mor Point Mutation ENU T-to-G transversion, which introduced a serine in place of an isoleucine at amino acid position 942 in the C-terminal region of the ddx46 protein. Kikuchi Lab ZDB-LAB-020408-3 Chr: 21 2019-09-17
ZDB-ALT-180917-1 ha7 7bp deletion, mutant #1 Small Deletion embryos treated with TALEN1-hey1 Kikuchi Lab ZDB-LAB-020408-3 Chr: 19 2019-09-17
ZDB-ALT-081014-1 hand2_unspecified un_hand2, unspecified_hand2 Unspecified Chr: 1 2019-09-17
ZDB-ALT-131107-1 hd10Tg Tg(pomc:Bal.bPAC-2A-Tomato)hd10 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(pomc:bPAC-2A-Tomato) ZDB-TGCONSTRCT-131107-1 2019-09-17
ZDB-ALT-150721-11 hd12Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(FRT-Xla.Actc1:DsRed-GAB-FRT-LOXP,otpa-LOXP-E1B:mmGFP-5HS4,myl7:RFP) ZDB-TGCONSTRCT-150721-7 2019-09-17
ZDB-ALT-150721-12 hd13Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(otpa-E1B:RFP-CAAX) ZDB-TGCONSTRCT-150721-8 2019-09-17
ZDB-ALT-150721-13 hd14Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(otpa-E1B:NTR-GFP) ZDB-TGCONSTRCT-150721-9 2019-09-17
ZDB-ALT-150323-3 hd15Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(otpa-hsp70l:GCaMP6s) ZDB-TGCONSTRCT-150323-3 2019-09-17
ZDB-ALT-150323-4 hd16Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(10xUAS:GCaMP6m) ZDB-TGCONSTRCT-150323-4 2019-09-17
ZDB-ALT-151214-1 hd17Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(-2star:GFP,myl7:RFP) ZDB-TGCONSTRCT-151214-1 2019-09-17
ZDB-ALT-151214-2 hd18Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(-2star:NTR-GFP,myl7:RFP) ZDB-TGCONSTRCT-151214-2 2019-09-17
ZDB-ALT-151214-3 hd19Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(-2star:bPAC-2A-Tomato) ZDB-TGCONSTRCT-151214-3 2019-09-17
ZDB-ALT-140908-1 hd1Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Et(otpa:GFP) ZDB-ETCONSTRCT-140908-1 2019-09-17
ZDB-ALT-161121-1 hd20Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(pomca:EGFP-Aequorin) ZDB-TGCONSTRCT-161121-2 2019-09-17
ZDB-ALT-160510-7 hd21Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped TgBAC(crhb:TagRFP) ZDB-TGCONSTRCT-160510-1 2019-09-17
ZDB-ALT-160510-8 hd22Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(otpa-hsp70l:GCaMP3.0) ZDB-TGCONSTRCT-160510-2 2019-09-17
ZDB-ALT-180119-6 hd23Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(otpa-E1B:LOX2272-LOXP-MA-RFP-LOX2272-MA-YFP-LOXP-MA-CFP) ZDB-TGCONSTRCT-180119-6 2019-09-17
ZDB-ALT-180119-7 hd24Tg Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(oxt:LOX2272-LOXP-MA-RFP-LOX2272-MA-YFP-LOXP-MA-CFP) ZDB-TGCONSTRCT-180119-7 2019-09-17
ZDB-ALT-130208-3 hd2Tg Tg(10xUAS:GCaMP3)hd2 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(10xUAS:GCaMP3) ZDB-TGCONSTRCT-130208-3 2019-09-17
ZDB-ALT-130208-5 hd3Tg Tg(Oh:G-3), Tg(otpa-hsp70l:Gal4-VP16,myl7:EGFP)hd3 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(otpa-hsp70l:GAL4-VP16,myl7:EGFP) ZDB-TGCONSTRCT-130208-5 2019-09-17
ZDB-ALT-130208-6 hd4Tg Tg(Oh:G-4), Tg(otpa-hsp70l:Gal4-VP16,myl7:EGFP)hd4 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(otpa-hsp70l:GAL4-VP16,myl7:EGFP) ZDB-TGCONSTRCT-130208-5 2019-09-17
ZDB-ALT-130208-4 hd5Tg Tg(elavl3.1:Gal4-VP16)hd5 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg1(elavl3:GAL4-VP16) ZDB-TGCONSTRCT-130208-4 2019-09-17
ZDB-ALT-130430-2 hd6Tg Tg(hsp70l:fezf2,EGFP)hd6 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(hsp70l:fezf2,EGFP) ZDB-TGCONSTRCT-130430-2 2019-09-17
ZDB-ALT-130430-3 hd7Tg Tg(hsp70l:otpa,EGFP)hd7 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(hsp70l:otpa,EGFP) ZDB-TGCONSTRCT-130430-3 2019-09-17
ZDB-ALT-130430-4 hd8Tg Tg(hsp70l:sim1a,LMA-Tomato)hd8 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(hsp70l:sim1a,LY-Tomato) ZDB-TGCONSTRCT-130430-4 2019-09-17
ZDB-ALT-130430-5 hd9Tg Tg(hsp70l:foxb1a,EGFP)hd9 Transgenic Insertion embryos treated with DNA Ryu Lab ZDB-LAB-081210-1 Unmapped Tg(hsp70l:foxb1a,EGFP) ZDB-TGCONSTRCT-130430-5 2019-09-17
ZDB-ALT-180207-11 hdb10Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR2-pycard Maria Leptin Lab ZDB-LAB-161209-2 Chr: 16 Tg(linker-EGFP) ZDB-TGCONSTRCT-180207-3 2019-09-17
ZDB-ALT-180207-13 hdb11 Small Deletion embryos treated with CRISPR1-caspa Maria Leptin Lab ZDB-LAB-161209-2 Chr: 16 2019-09-17
ZDB-ALT-180207-12 hdb12 Insertion embryos treated with CRISPR1-caspa insertion of 9 bp adds one lysine (K) and two stop codons in the caspa reading frame Maria Leptin Lab ZDB-LAB-161209-2 Chr: 16 2019-09-17
ZDB-ALT-120815-1 hdb1Tg Tg(actb2:GCaMP3)hdb1 Transgenic Insertion embryos treated with DNA Peri Lab ZDB-LAB-120810-1 Unmapped Tg(actb2:GCaMP3) ZDB-TGCONSTRCT-120815-1 2019-09-17
ZDB-ALT-120927-1 hdb2Tg Tg(spi1b:Gal4,UAS:TagRFP)hdb2 Transgenic Insertion embryos treated with DNA Peri Lab ZDB-LAB-120810-1 Unmapped Tg(spi1b:GAL4,UAS:TagRFP) ZDB-TGCONSTRCT-120927-1 2019-09-17
ZDB-ALT-121109-2 hdb3Tg TgBAC(p2ry12:p2ry12-GFP)hdb3 Transgenic Insertion embryos treated with DNA Peri Lab ZDB-LAB-120810-1 Unmapped TgBAC(p2ry12:p2ry12-GFP) ZDB-TGCONSTRCT-121109-1 2019-09-17
ZDB-ALT-151006-2 hdb4Tg Transgenic Insertion DNA Peri Lab ZDB-LAB-120810-1 Unmapped Tg(slc7a7:Kaede) ZDB-TGCONSTRCT-151006-1 2019-09-17
ZDB-ALT-161209-5 hdb5Tg Transgenic Insertion embryos treated with DNA Maria Leptin Lab ZDB-LAB-161209-2 Unmapped Tg(8xHsa.NFKB:GFP,Luciferase) ZDB-TGCONSTRCT-161209-5 2019-09-17
ZDB-ALT-170110-1 hdb6Tg Transgenic Insertion embryos treated with DNA Peri Lab ZDB-LAB-120810-1 Unmapped Tg(Xla.Tubb:LEXPR-SEC-Hsa.ANXA5-TagBFP) ZDB-TGCONSTRCT-170110-1 2019-09-17
ZDB-ALT-170110-2 hdb7Tg Transgenic Insertion embryos treated with DNA Peri Lab ZDB-LAB-120810-1 Unmapped Tg(Xla.Tubb:LEXPR-NTR-mCherry) ZDB-TGCONSTRCT-170110-2 2019-09-17
ZDB-ALT-170110-3 hdb8Tg Transgenic Insertion embryos treated with DNA Peri Lab ZDB-LAB-120810-1 Unmapped Tg(spi1b:GAL4,UAS:LIFEACT-EGFP) ZDB-TGCONSTRCT-170110-3 2019-09-17
ZDB-ALT-180207-10 hdb9Tg Transgenic Insertion embryos treated with DNA Maria Leptin Lab ZDB-LAB-161209-2 Unmapped Tg(HSE:pycard-MKATE2,myl7:TagRFP) ZDB-TGCONSTRCT-180207-2 2019-09-17
ZDB-ALT-091019-1 hg1 w84x Point Mutation adult males treated with ENU truncation of the mutant protein is in the Runt domain P. Paul Liu Lab ZDB-LAB-001018-1 Chr: 1 2019-09-17
ZDB-ALT-130531-1 hg10 Small Deletion embryos treated with zinc finger nuclease 4bp deletion in exon 3, cDNA: 215delACCT, p:N72IfsX25 P. Paul Liu Lab ZDB-LAB-001018-1 Chr: 18 2019-09-17
ZDB-ALT-190201-4 hg100 Small Deletion embryos treated with CRISPR1-snrnp48 Burgess Lab ZDB-LAB-010711-1 Chr: 16 2019-09-17
ZDB-ALT-190201-5 hg101 Small Deletion embryos treated with CRISPR1-ctnnb1 Burgess Lab ZDB-LAB-010711-1 Chr: 16 2019-09-17
ZDB-ALT-190201-6 hg102 Small Deletion embryos treated with CRISPR1-taf5 Burgess Lab ZDB-LAB-010711-1 Chr: 1 2019-09-17
ZDB-ALT-190201-7 hg103 Small Deletion embryos treated with CRISPR1-mgat5bl Burgess Lab ZDB-LAB-010711-1 Unmapped 2019-09-17
ZDB-ALT-190402-18 hg104 Indel Insertion of 2 nucleotides. Changed the nucleotide T in GRCz10/DanRer10 Chr5: 43204438 to GTC, resulting in a Y98X Burgess Lab ZDB-LAB-010711-1 Chr: 5 2019-09-17
ZDB-ALT-190402-16 hg105 Indel embryos treated with CRISPR Changed the 11 nucleotides in GRCz10/DanRer10 Chr8: 28236560-28236571 to 2 nucleotides GA. Burgess Lab ZDB-LAB-010711-1 Chr: 8 2019-09-17
ZDB-ALT-190402-17 hg106 Small Deletion embryos treated with CRISPR Deleted the 9 nucleotides in GRCz10/DanRer10 Chr8: 28236552-28236560 Burgess Lab ZDB-LAB-010711-1 Chr: 8 2019-09-17
ZDB-ALT-190402-15 hg107 Small Deletion embryos treated with CRISPR Burgess Lab ZDB-LAB-010711-1 Chr: 21 2019-09-17
ZDB-ALT-190402-14 hg108 Small Deletion embryos treated with CRISPR Burgess Lab ZDB-LAB-010711-1 Chr: 17 2019-09-17
ZDB-ALT-190402-13 hg109 Insertion embryos treated with CRISPR Burgess Lab ZDB-LAB-010711-1 Chr: 15 2019-09-17
ZDB-ALT-130531-2 hg11 Insertion embryos treated with zinc finger nuclease 4bp insertion in exon3, cDNA: 215insACCT, p:H74PfsX43 P. Paul Liu Lab ZDB-LAB-001018-1 Chr: 18 2019-09-17
ZDB-ALT-190402-12 hg110 Small Deletion embryos treated with CRISPR Burgess Lab ZDB-LAB-010711-1 Chr: 11 2019-09-17
ZDB-ALT-190402-11 hg111 Small Deletion embryos treated with CRISPR Burgess Lab ZDB-LAB-010711-1 Chr: 18 2019-09-17
ZDB-ALT-190402-10 hg112 Insertion embryos treated with CRISPR Insertion of 7 nucleotides, around the CRISPR target of
Chr1:28256827-28256849. (GRCz10/DanRer10) Burgess Lab ZDB-LAB-010711-1 Chr: 1 2019-09-17
ZDB-ALT-190402-9 hg113 Small Deletion : Deletion of 8 nucleotides, around the CRISPR target of
Chr4:16893648-16893670. (GRCz10/DanRer10) Burgess Lab ZDB-LAB-010711-1 Chr: 4 2019-09-17
ZDB-ALT-190402-7 hg114 Small Deletion embryos treated with CRISPR Burgess Lab ZDB-LAB-010711-1 Chr: 10 2019-09-17
ZDB-ALT-190402-6 hg115 Small Deletion embryos treated with CRISPR Deletion of 7 nucleotides, around the CRISPR target of Chr23:25331401-25331423. (GRCz10/DanRer10) Burgess Lab ZDB-LAB-010711-1 Chr: 23 2019-09-17
ZDB-ALT-130820-103 hg12 Insertion embryos treated with zinc finger nuclease Insertion of 4bp in exon 2, cDNA: 131insCATC, p:L44PfsX21 (from submitter) Sood Lab ZDB-LAB-130820-3 Chr: 20 2019-09-17
ZDB-ALT-130820-104 hg13 Indel embryos treated with zinc finger nuclease From submitter: Complex mutation in exon 2, cDNA: del95-132, ins 22bp; p:G32VfsX48 Sood Lab ZDB-LAB-130820-3 Chr: 20 2019-09-17
ZDB-ALT-140415-3 hg14 del2 Small Deletion embryos treated with zinc finger nuclease Deletion of 2 bps in exon1, cDNA: 45delAA, p:K16RfsX62 Sood Lab ZDB-LAB-130820-3 Chr: 19 2019-09-17
ZDB-ALT-140415-4 hg15 ins4 Insertion embryos treated with zinc finger nuclease Insertion of 4bp in exon 1, cDNA: 41insACGG; p:K16TfsX64 Sood Lab ZDB-LAB-130820-3 Chr: 19 2019-09-17
ZDB-ALT-140415-5 hg16 L124P Point Mutation adult males treated with ENU Point mutation in exon 4, cDNA: T371C; p:L124P ; T371C/L124P missense mutation
within exon 4 of the AK2 gene. The mutated amino acid in this mutant falls in a highly conserved region of AK2 located upstream of the beta sheet connecting the CORE domain to the LID domain. The L124P mutation has a PROVEAN score equal to -6.9 and was predicted to affect protein stability and enzymatic activity. Sood Lab ZDB-LAB-130820-3 Chr: 19 2019-09-17
ZDB-ALT-150826-1 hg17 Point Mutation adult males treated with ENU point mutation in intron 11, which affects splicing, cDNA:IVS10-261T>A; p:E616GfsX15 Sood Lab ZDB-LAB-130820-3 Chr: 1 2019-09-17
ZDB-ALT-150826-2 hg18 Point Mutation adult males treated with ENU Point mutation in exon 12, cDNA:C2185T; p:R729C Sood Lab ZDB-LAB-130820-3 Chr: 1 2019-09-17
ZDB-ALT-150805-2 hg19 Small Deletion embryos treated with zinc finger nuclease Deletion 5 bp in exon 2, cDNA:291delGATAA, p:D98KfsX3 Sood Lab ZDB-LAB-130820-3 Chr: 14 2019-09-17
ZDB-ALT-100722-1 hg2 T301K Point Mutation adult males treated with ENU P. Paul Liu Lab ZDB-LAB-001018-1 Chr: 11 2019-09-17
ZDB-ALT-150805-3 hg20 Small Deletion embryos treated with zinc finger nuclease Deletion of 7 bp in exon 2, cDNA:285delCGACAAG; p:R96IfsX27 Sood Lab ZDB-LAB-130820-3 Chr: 14 2019-09-17
ZDB-ALT-150805-4 hg21 Indel embryos treated with zinc finger nuclease insertion of 8bp in exon 2, cDNA: 288delCAAGATAAAinsAAGGAAAAGGTGAGGAT; p:Q97KfsX32\n\n Sood Lab ZDB-LAB-130820-3 Chr: 14 2019-09-17
ZDB-ALT-150826-3 hg22 Small Deletion embryos treated with CRISPR Deletion of 1 bp in exon 5, cDNA:962delT; p:F321SfsX6 Sood Lab ZDB-LAB-130820-3 Chr: 1 2019-09-17
ZDB-ALT-150826-4 hg23 Small Deletion embryos treated with CRISPR Deletion of 4 bp in exon 5, cDNA:961delTTCG; p:F321GfsX5 Sood Lab ZDB-LAB-130820-3 Chr: 1 2019-09-17
ZDB-ALT-151118-4 hg24 Small Deletion embryos treated with CRISPR Deletion 7 bp in exon 3, cDNA: 692delTCCGGCG; p:I231SfsX11 Sood Lab ZDB-LAB-130820-3 Chr: 15 2019-09-17
ZDB-ALT-151118-5 hg25 Indel embryos treated with CRISPR Insertion 34 bp in exon 3, cDNA: 698delGGCAinsAGGCGGAGCAGGTGGAGCAGGCGGCAGGCGGAGCAGGC; p:R233QfsX31 Sood Lab ZDB-LAB-130820-3 Chr: 15 2019-09-17
ZDB-ALT-151118-1 hg26 Small Deletion embryos treated with CRISPR Deletion 5 bp in exon 2, cDNA: 227delTGCAG; p:V76GfsX4 Sood Lab ZDB-LAB-130820-3 Chr: 24 2019-09-17
ZDB-ALT-151118-2 hg27 Insertion embryos treated with CRISPR Insertion 7 bp in exon 2, cDNA: 227insGTACTTT; p:V76GfsX8 Sood Lab ZDB-LAB-130820-3 Chr: 24 2019-09-17
ZDB-ALT-151118-3 hg28 Small Deletion embryos treated with CRISPR Deletion 2 bp in exon 7, cDNA: 1173delTTTinsG; p:L392EfsX6 Sood Lab ZDB-LAB-130820-3 Chr: 24 2019-09-17
ZDB-ALT-160622-1 hg29 Small Deletion embryos treated with CRISPR3-mgat5, CRISPR4-mgat5 Deletion of >49 kb between exons 3 and 10: ZV9 co-ordinates for deleted part: Chr22:12118738—12167938; P124SfsX24; This deletion was created using 2 CRISPRs, CRISPR3-mgat5 and CRISPR4-mgat5. Sood Lab ZDB-LAB-130820-3 Chr: 22 2019-09-17
ZDB-ALT-100722-2 hg3 K333R Point Mutation adult males treated with ENU P. Paul Liu Lab ZDB-LAB-001018-1 Chr: 11 2019-09-17
ZDB-ALT-160909-1 hg30Tg Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.IRX-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-160909-3 2019-09-17
ZDB-ALT-160909-2 hg31Tg Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg2(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.IRX-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-160909-4 2019-09-17
ZDB-ALT-160909-3 hg32Tg Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg3(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.IRX-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-160909-5 2019-09-17
ZDB-ALT-160909-4 hg33Tg Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg4(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.IRX4-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-160909-6 2019-09-17
ZDB-ALT-161212-7 hg34 Small Deletion embryos treated with zinc finger nuclease Deletion 5 bp in exon 1, cDNA: 90delACGGG; p:R31EfsX24 Sood Lab ZDB-LAB-130820-3 Chr: 10 2019-09-17
ZDB-ALT-161212-8 hg35 Insertion embryos treated with zinc finger nuclease Insertion 4 bp in exon 1, cDNA: 95insCGGG; p:V32AfsX26 Sood Lab ZDB-LAB-130820-3 Chr: 10 2019-09-17
ZDB-ALT-170801-10 hg36 Point Mutation adult males treated with ENU Point mutation in exon 2, cDNA: C103T; p: Q35X Sood Lab ZDB-LAB-130820-3 Chr: 3 2019-09-17
ZDB-ALT-170801-11 hg37 Indel embryos treated with CRISPR1-npc1 NM_001243875.1 (npc1_v001): c.933delinsATCAG. This mutation results in a frameshift and the formation of a stop codon 6 amino acids after of the mutation site. Sood Lab ZDB-LAB-130820-3 Chr: 2 2019-09-17
ZDB-ALT-170801-8 hg38 Small Deletion embryos treated with CRISPR1-trnt1 10 bp deletion in exon 6, cDNA: 704delTCTGGGTGGA, p. I235SfsX21 Sood Lab ZDB-LAB-130820-3 Chr: 6 2019-09-17
ZDB-ALT-170801-9 hg39 Small Deletion embryos treated with CRISPR1-trnt1 13 bp deletion in exon 6, cDNA: 696delCGAGAGGATCTGG, p. E233WfsX3. Sood Lab ZDB-LAB-130820-3 Chr: 6 2019-09-17
ZDB-ALT-100716-1 hg4 A76T Point Mutation adult males treated with ENU This mutant carries a guanosine 226 to adenosine substitution, converting the conserved alanine at residue 76 to threonine. Sood Lab ZDB-LAB-130820-3 Chr: 18 2019-09-17
ZDB-ALT-170809-9 hg40 Small Deletion embryos treated with CRISPR1-fanca Sood Lab ZDB-LAB-130820-3 Chr: 25 2019-09-17
ZDB-ALT-170809-10 hg41 Small Deletion embryos treated with CRISPR1-fanca by RT-PCR this mutation also leads to skipping of exon 12 resulting in protein of E378AfsX12. Sood Lab ZDB-LAB-130820-3 Chr: 25 2019-09-17
ZDB-ALT-170809-11 hg42 Small Deletion embryos treated with CRISPR1-fancb Deletion 4 bp in exon 1, cDNA: 832delTTCC,
p. F278RfsX43. Sood Lab ZDB-LAB-130820-3 Chr: 9 2019-09-17
ZDB-ALT-170809-12 hg43 Small Deletion embryos treated with CRISPR1-fancc Deletion 1 bp in exon 1, cDNA: 103delC, p. G36X. Sood Lab ZDB-LAB-130820-3 Chr: 8 2019-09-17
ZDB-ALT-170809-13 hg44 Small Deletion Sood Lab ZDB-LAB-130820-3 Unmapped 2019-09-17
ZDB-ALT-170809-2 hg45 Indel embryos treated with CRISPR2-brca2 Insertion 5 bp in exon 10, cDNA: 1066delAACAACAinsGAATTAAGTTAT, p. N356EfsX75 Sood Lab ZDB-LAB-130820-3 Chr: 15 2019-09-17
ZDB-ALT-170809-14 hg46 Small Deletion embryos treated with CRISPR1-fancd2 Sood Lab ZDB-LAB-130820-3 Chr: 6 2019-09-17
ZDB-ALT-170809-15 hg47 Small Deletion embryos treated with CRISPR1-fancd2 Deletion 20 bp in exon 16, cDNA: 1373delTGTACAAACAGGCCTTCACT, p. M458SfsX3. Sood Lab ZDB-LAB-130820-3 Chr: 6 2019-09-17
ZDB-ALT-170809-16 hg48 Small Deletion embryos treated with CRISPR1-fance Deletion 2 bp in exon 2, cDNA: 472delGG,
p. G158RfsX7. Sood Lab ZDB-LAB-130820-3 Chr: 8 2019-09-17
ZDB-ALT-170809-17 hg49 Small Deletion CRISPR CRISPR1-fance Sood Lab ZDB-LAB-130820-3 Chr: 8 2019-09-17
ZDB-ALT-100730-2 hg5 Q658X Point Mutation adult males treated with ENU hg5 (brca2 Q658X) has a C-to-T point mutation within exon 11 (C1971T) that changes glutamine (Q) to stop (X). hg5 homozygotes are viable and phenotypically male, whereas WT and heterozygous siblings show similar ratios of male and female fish. hg5 homozygotes induced egg laying in fertile WT females, but eggs collected from these crosses are unfertilized. (adapted from Shive et al. ZDB-PUB-101027-46 ) P. Paul Liu Lab ZDB-LAB-001018-1 Chr: 15 2019-09-17
ZDB-ALT-170809-18 hg50 Small Deletion embryos treated with CRISPR1-fancf Deletion 4 bp in exon 1, cDNA: 92delCACA,
p. T31SfsX31. Sood Lab ZDB-LAB-130820-3 Chr: 25 2019-09-17
ZDB-ALT-170809-19 hg51 Indel CRISPR CRISPR1-fancf Sood Lab ZDB-LAB-130820-3 Chr: 25 2019-09-17
ZDB-ALT-170809-20 hg52 Indel CRISPR CRISPR1-fancg Sood Lab ZDB-LAB-130820-3 Chr: 5 2019-09-17
ZDB-ALT-170809-21 hg53 Small Deletion embryos treated with CRISPR1-fancg Deletion 7 bp in exon 5, cDNA: 543delCTCACTA,
p. S182WfsX26. Sood Lab ZDB-LAB-130820-3 Chr: 5 2019-09-17
ZDB-ALT-170809-22 hg54 Small Deletion embryos treated with CRISPR1-fanci Deletion 8 bp in exon 13, cDNA: 1205delCATTCGGA,
p. P402QfsX11. Sood Lab ZDB-LAB-130820-3 Chr: 25 2019-09-17
ZDB-ALT-170809-23 hg55 Indel CRISPR CRISPR1-fanci Sood Lab ZDB-LAB-130820-3 Chr: 25 2019-09-17
ZDB-ALT-170809-3 hg56 Small Deletion embryos treated with CRISPR1-brip1 Deletion 5 bp in exon 5, cDNA: 643delGAATT,
p. L216QfsX6. Sood Lab ZDB-LAB-130820-3 Chr: 15 2019-09-17
ZDB-ALT-170809-4 hg57 Small Deletion CRISPR CRISPR1-brip1 Sood Lab ZDB-LAB-130820-3 Chr: 15 2019-09-17
ZDB-ALT-170809-24 hg58 Insertion embryos treated with CRISPR1-fancl Insertion 25 bp in exon 8, cDNA: 545insGATTGATATGATTTATGTTGATGGC, p. S177PfsX7. Sood Lab ZDB-LAB-130820-3 Chr: 13 2019-09-17
ZDB-ALT-170809-25 hg59 Small Deletion embryos treated with CRISPR1-fancl Sood Lab ZDB-LAB-130820-3 Chr: 13 2019-09-17
ZDB-ALT-100817-1 hg6 Point Mutation adult males treated with ENU Sood Lab ZDB-LAB-130820-3 Chr: 20 2019-09-17
ZDB-ALT-170809-26 hg60 Small Deletion CRISPR CRISPR1-fancm Sood Lab ZDB-LAB-130820-3 Chr: 17 2019-09-17
ZDB-ALT-170809-27 hg61 Insertion embryos treated with CRISPR1-fancm Insertion 4 bp in exon 2, cDNA: 200insATCT,
p. R67HfsX21. Sood Lab ZDB-LAB-130820-3 Chr: 17 2019-09-17
ZDB-ALT-170809-28 hg62 Small Deletion embryos treated with CRISPR1-palb2 Deletion 11 bp in exon 4, cDNA: 1233delGACTGTAGGAC, p. T412HfsX15 Sood Lab ZDB-LAB-130820-3 Chr: 1 2019-09-17
ZDB-ALT-170809-29 hg63 Small Deletion embryos treated with CRISPR1-palb2 Sood Lab ZDB-LAB-130820-3 Chr: 1 2019-09-17
ZDB-ALT-170809-30 hg64 Small Deletion CRISPR CRISPR1-rad51c Sood Lab ZDB-LAB-130820-3 Chr: 10 2019-09-17
ZDB-ALT-170809-31 hg65 Indel embryos treated with CRISPR1-rad51c Sood Lab ZDB-LAB-130820-3 Chr: 10 2019-09-17
ZDB-ALT-170809-34 hg66 Small Deletion embryos treated with CRISPR1-slx4 CTCTGCT Sood Lab ZDB-LAB-130820-3 Chr: 22 2019-09-17
ZDB-ALT-170809-35 hg67 Small Deletion embryos treated with CRISPR1-slx4 Insertion 2 bp in exon 5, cDNA: 706delACinsTACA,
p. T236YfsX44. Sood Lab ZDB-LAB-130820-3 Chr: 22 2019-09-17
ZDB-ALT-170809-5 hg68 Small Deletion CRISPR CRISPR1-ercc4 Sood Lab ZDB-LAB-130820-3 Chr: 12 2019-09-17
ZDB-ALT-170809-6 hg69 Indel embryos treated with CRISPR1-ercc4 Insertion 2 bp in exon 5, cDNA: 706delACinsTACA,
p. T236YfsX44. Sood Lab ZDB-LAB-130820-3 Chr: 12 2019-09-17
ZDB-ALT-100817-2 hg7 Point Mutation adult males treated with ENU Sood Lab ZDB-LAB-130820-3 Chr: 20 2019-09-17
ZDB-ALT-170809-36 hg70 Small Deletion embryos treated with CRISPR1-ube2t Sood Lab ZDB-LAB-130820-3 Chr: 23 2019-09-17
ZDB-ALT-170809-37 hg71 Indel embryos treated with CRISPR1-ube2t Insertion 13 bp in exon 3, cDNA: 296delCCGTinsGAAGGTGAAGTGTCTGG, p. P84EfsX7. Sood Lab ZDB-LAB-130820-3 Chr: 23 2019-09-17
ZDB-ALT-170809-32 hg72 Small Deletion embryos treated with CRISPR1-si:dkey-57h18.1 Deletion 4 bp in exon 6, cDNA: 1133delACCC,
p. N378KfsX16. Sood Lab ZDB-LAB-130820-3 Chr: 12 2019-09-17
ZDB-ALT-170809-33 hg73 Small Deletion embryos treated with CRISPR1-si:dkey-57h18.1 Sood Lab ZDB-LAB-130820-3 Chr: 12 2019-09-17
ZDB-ALT-170809-7 hg74 Small Deletion embryos treated with CRISPR1-faap24 Deletion 2 bp in exon 2, cDNA: 189delGT, p. S64RfsX3. Sood Lab ZDB-LAB-130820-3 Chr: 25 2019-09-17
ZDB-ALT-170809-8 hg75 Small Deletion embryos treated with CRISPR1-faap24 Sood Lab ZDB-LAB-130820-3 Chr: 25 2019-09-17
ZDB-ALT-180703-5 hg76 del10bp Small Deletion embryos treated with CRISPR1-hspe1 Mutation is a deletion of nucleotides 347 – 356 in NM_131526. Sood Lab ZDB-LAB-130820-3 Chr: 9 2019-09-17
ZDB-ALT-180703-6 hg77 del16bp Small Deletion embryos treated with CRISPR1-hspe1 Mutation was a deletion of nucleotides 368 – 373 in NM_131526.1. Sood Lab ZDB-LAB-130820-3 Chr: 9 2019-09-17
ZDB-ALT-180703-7 hg78 del12bp Small Deletion embryos treated with CRISPR1-hspa13 Mutation is a deletion of nucleotides 200-211 in NM_00108479. Sood Lab ZDB-LAB-130820-3 Chr: 15 2019-09-17
ZDB-ALT-180703-8 hg79 del16bp Small Deletion embryos treated with CRISPR1-hspa13 Mutation is a deletion of nucleotides 201-206 in NM_00108479. Sood Lab ZDB-LAB-130820-3 Chr: 15 2019-09-17
ZDB-ALT-180703-9 hg80 del1bp Small Deletion embryos treated with CRISPR2-gemin5 Mutation was a deletion of nucleotide of 1277 in XM_009295614. Sood Lab ZDB-LAB-130820-3 Chr: 21 2019-09-17
ZDB-ALT-180703-10 hg81 del20bp Small Deletion embryos treated with CRISPR2-gemin5 Mutation was a deletion of nucleotides 1285-1304 in XM_009295614. Sood Lab ZDB-LAB-130820-3 Chr: 21 2019-09-17
ZDB-ALT-180305-5 hg82 Indel embryos treated with zinc finger nuclease Puertollano Lab ZDB-LAB-180213-2 Ambiguous 2019-09-17
ZDB-ALT-180305-6 hg83 Small Deletion embryos treated with zinc finger nuclease Puertollano Lab ZDB-LAB-180213-2 Ambiguous 2019-09-17
ZDB-ALT-180305-7 hg84 Small Deletion embryos treated with CRISPR1-mcoln1b Puertollano Lab ZDB-LAB-180213-2 Chr: 3 2019-09-17
ZDB-ALT-180305-8 hg85 Small Deletion embryos treated with CRISPR1-mcoln1b Puertollano Lab ZDB-LAB-180213-2 Chr: 3 2019-09-17
ZDB-ALT-180626-3 hg86Tg C1 Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.rs1884302_C-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-180626-3 2019-09-17
ZDB-ALT-180626-4 hg87Tg C2 Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg(FRT-Xla.Actc1:DsRed-GAB-FRT,LOXP-Hsa.rs1884302_C-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-180626-3 2019-09-17
ZDB-ALT-180626-5 hg88Tg T1 Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg(FRT-Xla.ACTC1:DsRed-GAB-FRT,LOXP-Hsa.rs1884302_T-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-180626-4 2019-09-17
ZDB-ALT-180626-6 hg89Tg T2 Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg(FRT-Xla.ACTC1:DsRed-GAB-FRT,LOXP-Hsa.rs1884302_T-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-180626-4 2019-09-17
ZDB-ALT-101006-6 hg8Tg This feature is representative of one or more unknown insertion sites. ZM, ZM_00365842 Transgenic Insertion embryos treated with DNA This line was originally from Znomics. It has a 5.2kb retroviral DNA insertion just downstream of the mitochondrial eader signal of opa3. Feldman Lab ZDB-LAB-030703-2 Chr: 18 Tg(ZM) ZDB-TGCONSTRCT-101007-1 2019-09-17
ZDB-ALT-120606-9 hg9 mmy, mummy Point Mutation embryos treated with ENU P. Paul Liu Lab ZDB-LAB-001018-1 Chr: 12 2019-09-17
ZDB-ALT-180626-7 hg90Tg T3 Transgenic Insertion embryos treated with DNA Sood Lab ZDB-LAB-130820-3 Unmapped Tg(FRT-Xla.ACTC1:DsRed-GAB-FRT,LOXP-Hsa.rs1884302_T-LOXP-gata2a:EGFP-5HS4) ZDB-TGCONSTRCT-180626-4 2019-09-17
ZDB-ALT-190226-1 hg91 Small Deletion embryos treated with CRISPR8-tp53 Sood Lab ZDB-LAB-130820-3 Chr: 5 2019-09-17
ZDB-ALT-190201-3 hg99 8 bp deletion Small Deletion embryos treated with CRISPR1-snrnp25 Burgess Lab ZDB-LAB-010711-1 Chr: 3 2019-09-17
ZDB-ALT-110722-30 hh024 stumm stm hy024 Point Mutation hh024 has a guanosine-to-adenosine transition at the intron 3-exon 4 splice site of gfra3 on Chr. 14, resulting in loss of the canonical splice acceptor with a cryptic splice site in exon 4 used instead. gfra3 transcripts from stm hh024 mutants have a 26 bp deletion in the open reading frame, causing a frame shift and premature stop codon. The mutated Gfra3 protein in stm hh024 mutants lacks domains D2 and D3 necessary for binding GDNF family ligands. ( Knight et al. ZDB-PUB-110517-3 ) Roehl Lab ZDB-LAB-021119-1 Chr: 14 2019-09-17
ZDB-ALT-020426-18 hi1002Tg This feature is representative of one or more unknown insertion sites. hi1002 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-8 hi1011Tg This feature is representative of one or more unknown insertion sites. hi1011 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-12 hi1016Tg This feature is representative of one or more unknown insertion sites. hi1016 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040720-12 hi1019Tg This feature is representative of one or more unknown insertion sites. hi1019 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020430-46 hi1026Tg This feature is representative of one or more unknown insertion sites. hi1026 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-16 hi1034aTg This feature is representative of one or more unknown insertion sites. hi1034a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-10 hi1034bTg This feature is representative of one or more unknown insertion sites. hi1034b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-060811-8 hi1042Tg This feature is representative of one or more unknown insertion sites. hi1042 Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Unmapped Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-42 hi1045Tg This feature is representative of one or more unknown insertion sites. hi1045 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-28 hi1055aTg This feature is representative of one or more unknown insertion sites. hi1055a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-18 hi1055bTg This feature is representative of one or more unknown insertion sites. hi1055b Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand.; The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-20 hi1058Tg This feature is representative of one or more unknown insertion sites. hi1058 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-30 hi1059Tg This feature is representative of one or more unknown insertion sites. hi1059 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-8 hi1061Tg This feature is representative of one or more unknown insertion sites. hi1061 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand.; The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-10 hi1072Tg This feature is representative of one or more unknown insertion sites. hi1072 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-22 hi1073Tg This feature is representative of one or more unknown insertion sites. hi1073 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-2 hi1086aTg This feature is representative of one or more unknown insertion sites. hi1086a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020422-4 hi10Tg This feature is representative of one or more unknown insertion sites. hi10 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040721-4 hi1113aTg This feature is representative of one or more unknown insertion sites. hi1113a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-16 hi1113bTg This feature is representative of one or more unknown insertion sites. hi1113b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-68 hi1116aTg This feature is representative of one or more unknown insertion sites. hi1116a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-38 hi1116bTg This feature is representative of one or more unknown insertion sites. hi1116b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-18 hi1124Tg This feature is representative of one or more unknown insertion sites. hi1124 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041026-6 hi1126Tg This feature is representative of one or more unknown insertion sites. hi1126 Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020422-2 hi112Tg This feature is representative of one or more unknown insertion sites. hi112 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-030219-4 hi1134Tg This feature is representative of one or more unknown insertion sites. hi1134 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-2 hi1143Tg This feature is representative of one or more unknown insertion sites. hi1143 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-28 hi1146Tg This feature is representative of one or more unknown insertion sites. hi1146 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-46 hi1159Tg This feature is representative of one or more unknown insertion sites. hi1159 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040714-6 hi1167Tg This feature is representative of one or more unknown insertion sites. hi1167 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-50 hi1182Tg This feature is representative of one or more unknown insertion sites. hi1182 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-6 hi1193Tg This feature is representative of one or more unknown insertion sites. hi1193 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-6 hi1207Tg This feature is representative of one or more unknown insertion sites. hi1207 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-18 hi1227Tg This feature is representative of one or more unknown insertion sites. hi1227 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-30 hi1241Tg This feature is representative of one or more unknown insertion sites. hi1241 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-4 hi1244Tg This feature is representative of one or more unknown insertion sites. hi1244 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-98 hi1257Tg This feature is representative of one or more unknown insertion sites. hi1257 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-24 hi1262Tg This feature is representative of one or more unknown insertion sites. hi1262 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040223-8 hi1269Tg This feature is representative of one or more unknown insertion sites. hi1269 Transgenic Insertion embryos treated with DNA Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-42 hi1284Tg This feature is representative of one or more unknown insertion sites. hi1284 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040722-2 hi1290Tg This feature is representative of one or more unknown insertion sites. hi1290 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-12 hi1297Tg This feature is representative of one or more unknown insertion sites. hi1297 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-32 hi1320Tg This feature is representative of one or more unknown insertion sites. hi1320 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 25 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040129-14 hi1321Tg This feature is representative of one or more unknown insertion sites. hi1321 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040722-4 hi1326Tg This feature is representative of one or more unknown insertion sites. hi1326 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040130-2 hi1359aTg This feature is representative of one or more unknown insertion sites. hi1359a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040223-2 hi1364aTg This feature is representative of one or more unknown insertion sites. hi1364a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040217-8 hi1364bTg This feature is representative of one or more unknown insertion sites. hi1364b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040722-10 hi1370Tg This feature is representative of one or more unknown insertion sites. hi1370 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-52 hi1371Tg This feature is representative of one or more unknown insertion sites. hi1371 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-100 hi1373Tg This feature is representative of one or more unknown insertion sites. hi1373 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050805-8 hi1384Tg This feature is representative of one or more unknown insertion sites. hi1384 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040722-14 hi1386Tg This feature is representative of one or more unknown insertion sites. hi1386 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-22 hi1389Tg This feature is representative of one or more unknown insertion sites. hi1389 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040709-6 hi138Tg This feature is representative of one or more unknown insertion sites. hi138 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040722-16 hi1392Tg This feature is representative of one or more unknown insertion sites. hi1392 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-18 hi1411Tg This feature is representative of one or more unknown insertion sites. hi1411 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040723-2 hi1422Tg This feature is representative of one or more unknown insertion sites. hi1422 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-10 hi1433Tg This feature is representative of one or more unknown insertion sites. hi1433 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040723-8 hi1437Tg This feature is representative of one or more unknown insertion sites. hi1437 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-20 hi1444Tg This feature is representative of one or more unknown insertion sites. hi1444 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-76 hi1447Tg This feature is representative of one or more unknown insertion sites. hi1447 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040726-6 hi1451Tg This feature is representative of one or more unknown insertion sites. hi1451 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-12 hi1463Tg This feature is representative of one or more unknown insertion sites. hi1463 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-14 hi1464Tg This feature is representative of one or more unknown insertion sites. hi1464 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040727-2 hi1477Tg This feature is representative of one or more unknown insertion sites. hi1477 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040727-6 hi1479Tg This feature is representative of one or more unknown insertion sites. hi1479 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020726-2 hi1482Tg This feature is representative of one or more unknown insertion sites. hi1482 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand.; hi1482 is a null allele of pwi with proviral insertion at 65 bp after the first exon of the pinball wizard (WRB) gene Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040727-8 hi1487Tg This feature is representative of one or more unknown insertion sites. hi1487 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020422-6 hi14Tg This feature is representative of one or more unknown insertion sites. hi14 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040217-16 hi1515Tg This feature is representative of one or more unknown insertion sites. hi1515 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040727-10 hi1516Tg This feature is representative of one or more unknown insertion sites. hi1516 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040727-14 hi1518Tg This feature is representative of one or more unknown insertion sites. hi1518 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-2 hi1520Tg This feature is representative of one or more unknown insertion sites. hi1520 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-6 hi1532aTg This feature is representative of one or more unknown insertion sites. hi1532a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040726-4 hi1532bTg This feature is representative of one or more unknown insertion sites. hi1532b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050913-2 hi1537Tg This feature is representative of one or more unknown insertion sites. hi1537 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-78 hi1548Tg This feature is representative of one or more unknown insertion sites. hi1548 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-8 hi1552Tg This feature is representative of one or more unknown insertion sites. hi1552 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-10 hi1573Tg This feature is representative of one or more unknown insertion sites. hi1573 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-32 hi1579Tg This feature is representative of one or more unknown insertion sites. hi1579 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-96 hi1581Tg This feature is representative of one or more unknown insertion sites. hi1581 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-24 hi1618Tg This feature is representative of one or more unknown insertion sites. hi1618 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-16 hi1621Tg This feature is representative of one or more unknown insertion sites. hi1621 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-011018-4 hi1640Tg This feature is representative of one or more unknown insertion sites. hi1640 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041027-2 hi1642Tg This feature is representative of one or more unknown insertion sites. hi1642 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-6 hi1688Tg This feature is representative of one or more unknown insertion sites. hi1688 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040310-4 hi1703Tg This feature is representative of one or more unknown insertion sites. hi1703 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand.; The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040310-2 hi1706Tg This feature is representative of one or more unknown insertion sites. hi1706 Transgenic Insertion embryos treated with DNA Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-14 hi1715Tg This feature is representative of one or more unknown insertion sites. hi1715 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-18 hi1722Tg This feature is representative of one or more unknown insertion sites. hi1722 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-20 hi1727Tg This feature is representative of one or more unknown insertion sites. hi1727 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-22 hi1730Tg This feature is representative of one or more unknown insertion sites. hi1730 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040803-2 hi1743Tg This feature is representative of one or more unknown insertion sites. hi1743 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040129-2 hi1757Tg This feature is representative of one or more unknown insertion sites. hi1757 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040804-2 hi1769Tg This feature is representative of one or more unknown insertion sites. hi1769 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040805-4 hi1779Tg This feature is representative of one or more unknown insertion sites. hi1779 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand.; A 6-kb retroviral insertion at base 553 in the coding sequence leads to a truncation of the protein at amino acid 197. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050805-4 hi1780aTg This feature is representative of one or more unknown insertion sites. hi1780a Transgenic Insertion embryos treated with DNA Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-8 hi1780bTg This feature is representative of one or more unknown insertion sites. hi1780b Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-8 hi1793Tg This feature is representative of one or more unknown insertion sites. hi1793 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-6 hi1807Tg This feature is representative of one or more unknown insertion sites. hi1807 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-060814-4 hi1830Tg This feature is representative of one or more unknown insertion sites. hi1830 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-34 hi1841bTg This feature is representative of one or more unknown insertion sites. hi1841b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-030715-8 hi1843Tg This feature is representative of one or more unknown insertion sites. hi1843 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-16 hi1856Tg This feature is representative of one or more unknown insertion sites. hi1856 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040805-2 hi1858aTg This feature is representative of one or more unknown insertion sites. hi1858a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040907-2 hi1858bTg This feature is representative of one or more unknown insertion sites. hi1858b Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040219-2 hi1867Tg This feature is representative of one or more unknown insertion sites. hi1867 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040907-4 hi1872Tg This feature is representative of one or more unknown insertion sites. hi1872 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-20 hi1883Tg This feature is representative of one or more unknown insertion sites. hi1883 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040907-10 hi1887Tg This feature is representative of one or more unknown insertion sites. hi1887 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-8 hi1902Tg This feature is representative of one or more unknown insertion sites. hi1902 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040908-2 hi1903cTg This feature is representative of one or more unknown insertion sites. hi1903c Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040220-10 hi1907Tg This feature is representative of one or more unknown insertion sites. hi1907 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040213-2 hi1934Tg This feature is representative of one or more unknown insertion sites. hi1934 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040129-4 hi1940Tg This feature is representative of one or more unknown insertion sites. hi1940 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040908-4 hi1942Tg This feature is representative of one or more unknown insertion sites. hi1942 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-20 hi1944Tg This feature is representative of one or more unknown insertion sites. hi1944 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040909-2 hi1950Tg This feature is representative of one or more unknown insertion sites. hi1950 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040909-4 hi1951Tg This feature is representative of one or more unknown insertion sites. hi1951 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-4 hi1974Tg This feature is representative of one or more unknown insertion sites. hi1974 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040910-2 hi1987Tg This feature is representative of one or more unknown insertion sites. hi1987 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040910-4 hi1988Tg This feature is representative of one or more unknown insertion sites. hi1988 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-26 hi199Tg This feature is representative of one or more unknown insertion sites. hi199 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-980203-345 hi1Tg This feature is representative of one or more unknown insertion sites. hi1 Transgenic Insertion adult males treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(SFG) ZDB-TGCONSTRCT-070117-176 2019-09-17
ZDB-ALT-040830-4 hi2005Tg This feature is representative of one or more unknown insertion sites. hi2005 Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Unmapped Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-4 hi2019Tg This feature is representative of one or more unknown insertion sites. hi2019 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040910-6 hi2026aTg This feature is representative of one or more unknown insertion sites. hi2026a Transgenic Insertion embryos treated with DNA Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040913-2 hi2039aTg This feature is representative of one or more unknown insertion sites. hi2039a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050805-6 hi2039bTg This feature is representative of one or more unknown insertion sites. hi2039b Transgenic Insertion embryos treated with DNA Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040913-4 hi2062Tg This feature is representative of one or more unknown insertion sites. hi2062 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-10 hi2068Tg This feature is representative of one or more unknown insertion sites. hi2068 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040129-10 hi2069Tg This feature is representative of one or more unknown insertion sites. hi2069 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040913-8 hi2078Tg This feature is representative of one or more unknown insertion sites. hi2078 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040914-2 hi2080Tg This feature is representative of one or more unknown insertion sites. hi2080 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040914-6 hi2091Tg This feature is representative of one or more unknown insertion sites. hi2091 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-20 hi2092Tg This feature is representative of one or more unknown insertion sites. hi2092 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040223-16 hi2108Tg This feature is representative of one or more unknown insertion sites. hi2108 Transgenic Insertion embryos treated with DNA Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-4 hi2109Tg This feature is representative of one or more unknown insertion sites. hi2109 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040722-8 hi2111Tg This feature is representative of one or more unknown insertion sites. hi2111 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040223-10 hi2122Tg This feature is representative of one or more unknown insertion sites. hi2122 Transgenic Insertion embryos treated with DNA Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-2 hi2137Tg This feature is representative of one or more unknown insertion sites. hi2137 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-8 hi2143Tg This feature is representative of one or more unknown insertion sites. hi2143 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040310-10 hi2144Tg This feature is representative of one or more unknown insertion sites. hi2144 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-12 hi2151Tg This feature is representative of one or more unknown insertion sites. hi2151 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-20 hi2155Tg This feature is representative of one or more unknown insertion sites. hi2155 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-66 hi215Tg This feature is representative of one or more unknown insertion sites. hi215 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-060918-4 hi2161Tg This feature is representative of one or more unknown insertion sites. hi2161 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-030715-6 hi2169Tg This feature is representative of one or more unknown insertion sites. hi2169 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040213-12 hi2188aTg This feature is representative of one or more unknown insertion sites. hi2188a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040917-2 hi2188bTg This feature is representative of one or more unknown insertion sites. hi2188b Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040310-6 hi2191Tg This feature is representative of one or more unknown insertion sites. hi2191 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040907-6 hi2203Tg This feature is representative of one or more unknown insertion sites. hi2203 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040827-6 hi2211Tg This feature is representative of one or more unknown insertion sites. hi2211 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040924-2 hi2216Tg This feature is representative of one or more unknown insertion sites. hi2216 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040924-4 hi2217Tg This feature is representative of one or more unknown insertion sites. hi2217 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040924-8 hi2226Tg This feature is representative of one or more unknown insertion sites. hi2226 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040924-10 hi2230Tg This feature is representative of one or more unknown insertion sites. hi2230 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040924-12 hi2246Tg This feature is representative of one or more unknown insertion sites. hi2246 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand.; The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040223-4 hi2249Tg This feature is representative of one or more unknown insertion sites. hi2249 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040217-18 hi2269Tg This feature is representative of one or more unknown insertion sites. hi2269 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-2 hi2271Tg This feature is representative of one or more unknown insertion sites. hi2271 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-4 hi2285Tg This feature is representative of one or more unknown insertion sites. hi2285 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-12 hi2289Tg This feature is representative of one or more unknown insertion sites. hi2289 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-14 hi2293Tg This feature is representative of one or more unknown insertion sites. hi2293 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-011018-2 hi229Tg This feature is representative of one or more unknown insertion sites. hi229 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040721-6 hi2327Tg This feature is representative of one or more unknown insertion sites. hi2327 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-20 hi2329aTg This feature is representative of one or more unknown insertion sites. hi2329a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040129-6 hi2329bTg This feature is representative of one or more unknown insertion sites. hi2329b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand.; The viral insert is within an intron of smoothened, not an exon (like hi1640) which most likely results in the less severe phenotype observed. (A. Wilbanks, pers. comm.) Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-24 hi2335Tg This feature is representative of one or more unknown insertion sites. hi2335 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-30 hi2345Tg This feature is representative of one or more unknown insertion sites. hi2345 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand.; Could have been created with either the F5 or GT virus (more likely GT, but cannot be sure) Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040715-12 hi2352Tg This feature is representative of one or more unknown insertion sites. hi2352 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand.; Could have been created with either the F5 or GT virus (more likely GT, but cannot be sure) Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050908-6 hi235Tg This feature is representative of one or more unknown insertion sites. hi235 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040930-12 hi2393Tg This feature is representative of one or more unknown insertion sites. hi2393 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-4 hi2394Tg This feature is representative of one or more unknown insertion sites. hi2394 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand.; The proviral insertion hi2394 is located in the first intron of reptin (ruvbl2). Expression of ruvbl2 mRNA and protein is dramatically reduced, if not completely abolished in hi2394 mutants. hi2394 is a loss-of-function allele of reptin. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040712-2 hi239Tg This feature is representative of one or more unknown insertion sites. hi239 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040217-14 hi2400Tg This feature is representative of one or more unknown insertion sites. hi2400 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-18 hi2404Tg This feature is representative of one or more unknown insertion sites. hi2404 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-24 hi2430Tg This feature is representative of one or more unknown insertion sites. hi2430 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-22 hi2437Tg This feature is representative of one or more unknown insertion sites. hi2437 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-20 hi2452Tg This feature is representative of one or more unknown insertion sites. hi2452 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-22 hi2453Tg This feature is representative of one or more unknown insertion sites. hi2453 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-28 hi2462Tg This feature is representative of one or more unknown insertion sites. hi2462 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041005-2 hi2470Tg This feature is representative of one or more unknown insertion sites. hi2470 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041005-4 hi2473Tg This feature is representative of one or more unknown insertion sites. hi2473 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041006-2 hi2479Tg This feature is representative of one or more unknown insertion sites. hi2479 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041006-4 hi2487Tg This feature is representative of one or more unknown insertion sites. hi2487 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041006-6 hi2491Tg This feature is representative of one or more unknown insertion sites. hi2491 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-060814-2 hi2497aTg This feature is representative of one or more unknown insertion sites. hi2497a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-56 hi2499aTg This feature is representative of one or more unknown insertion sites. hi2499a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040218-2 hi2505aTg This feature is representative of one or more unknown insertion sites. hi2505a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-14 hi2505bTg This feature is representative of one or more unknown insertion sites. hi2505b Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041006-8 hi2529Tg This feature is representative of one or more unknown insertion sites. hi2529 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-2 hi2557Tg This feature is representative of one or more unknown insertion sites. hi2557 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040728-4 hi2558Tg This feature is representative of one or more unknown insertion sites. hi2558 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-10 hi2561Tg This feature is representative of one or more unknown insertion sites. hi2561 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-6 hi2570Tg This feature is representative of one or more unknown insertion sites. hi2570 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-12 hi2573aTg This feature is representative of one or more unknown insertion sites. hi2573a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-14 hi2578Tg This feature is representative of one or more unknown insertion sites. hi2578 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-18 hi2581Tg This feature is representative of one or more unknown insertion sites. hi2581 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-16 hi2582Tg This feature is representative of one or more unknown insertion sites. hi2582 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-16 hi2586Tg This feature is representative of one or more unknown insertion sites. hi2586 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040217-12 hi2587Tg This feature is representative of one or more unknown insertion sites. hi2587 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-44 hi258Tg This feature is representative of one or more unknown insertion sites. hi258 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-041007-22 hi2596Tg This feature is representative of one or more unknown insertion sites. hi2596 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040217-2 hi2617Tg This feature is representative of one or more unknown insertion sites. hi2617 Transgenic Insertion embryos treated with DNA Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-24 hi2618Tg This feature is representative of one or more unknown insertion sites. hi2618 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040130-6 hi2628Tg This feature is representative of one or more unknown insertion sites. hi2628 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041008-2 hi2635Tg This feature is representative of one or more unknown insertion sites. hi2635 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041008-4 hi2639aTg This feature is representative of one or more unknown insertion sites. hi2639a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041008-6 hi2639bTg This feature is representative of one or more unknown insertion sites. hi2639b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040213-4 hi2639cTg This feature is representative of one or more unknown insertion sites. hi2639c Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041008-8 hi2648Tg This feature is representative of one or more unknown insertion sites. hi2648 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-2 hi2649Tg This feature is representative of one or more unknown insertion sites. hi2649 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041011-2 hi2653Tg This feature is representative of one or more unknown insertion sites. hi2653 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041011-4 hi2666Tg This feature is representative of one or more unknown insertion sites. hi2666 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041011-6 hi2667Tg This feature is representative of one or more unknown insertion sites. hi2667 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040709-2 hi2675Tg This feature is representative of one or more unknown insertion sites. hi2675 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040220-14 hi2677dTg This feature is representative of one or more unknown insertion sites. hi2677d Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040709-4 hi2688Tg This feature is representative of one or more unknown insertion sites. hi2688 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040713-14 hi2689Tg This feature is representative of one or more unknown insertion sites. hi2689 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040713-18 hi2694Tg This feature is representative of one or more unknown insertion sites. hi2694 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-36 hi2696Tg This feature is representative of one or more unknown insertion sites. hi2696 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040315-2 hi2704Tg This feature is representative of one or more unknown insertion sites. hi2704 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand.; The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040713-16 hi2705aTg This feature is representative of one or more unknown insertion sites. hi2705a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040130-4 hi2715Tg This feature is representative of one or more unknown insertion sites. hi2715 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040713-20 hi2718aTg This feature is representative of one or more unknown insertion sites. hi2718a Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040714-2 hi2718bTg This feature is representative of one or more unknown insertion sites. hi2718b Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040715-16 hi2720Tg This feature is representative of one or more unknown insertion sites. hi2720 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-38 hi2727Tg This feature is representative of one or more unknown insertion sites. hi2727 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040220-2 hi2729aTg This feature is representative of one or more unknown insertion sites. hi2729a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040714-10 hi2729bTg This feature is representative of one or more unknown insertion sites. hi2729b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040712-4 hi272Tg This feature is representative of one or more unknown insertion sites. hi272 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040714-12 hi2734Tg This feature is representative of one or more unknown insertion sites. hi2734 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040809-2 hi2735aTg This feature is representative of one or more unknown insertion sites. hi2735a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040213-6 hi2735bTg This feature is representative of one or more unknown insertion sites. hi2735b Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040811-2 hi2737Tg This feature is representative of one or more unknown insertion sites. hi2737 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand.; The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040223-6 hi2765Tg This feature is representative of one or more unknown insertion sites. hi2765 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-16 hi2769Tg This feature is representative of one or more unknown insertion sites. hi2769 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-14 hi2786aTg This feature is representative of one or more unknown insertion sites. hi2786a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040924-14 hi2786bTg This feature is representative of one or more unknown insertion sites. hi2786b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040823-2 hi2791Tg This feature is representative of one or more unknown insertion sites. hi2791 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040929-2 hi2799Tg This feature is representative of one or more unknown insertion sites. hi2799 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-18 hi2806Tg This feature is representative of one or more unknown insertion sites. hi2806 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040824-2 hi2820Tg This feature is representative of one or more unknown insertion sites. hi2820 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041011-8 hi2827aTg This feature is representative of one or more unknown insertion sites. hi2827a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040316-2 hi2827bTg This feature is representative of one or more unknown insertion sites. hi2827b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-16 hi2836Tg This feature is representative of one or more unknown insertion sites. hi2836 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040129-12 hi2839bTg This feature is representative of one or more unknown insertion sites. hi2839b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040914-4 hi2857Tg This feature is representative of one or more unknown insertion sites. hi2857 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040929-4 hi2865Tg This feature is representative of one or more unknown insertion sites. hi2865 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-4 hi2869Tg This feature is representative of one or more unknown insertion sites. hi2869 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040712-8 hi286Tg This feature is representative of one or more unknown insertion sites. hi286 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040824-4 hi2877aTg This feature is representative of one or more unknown insertion sites. hi2877a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-26 hi2877bTg This feature is representative of one or more unknown insertion sites. hi2877b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040622-14 hi2903Tg This feature is representative of one or more unknown insertion sites. hi2903 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-8 hi2908Tg This feature is representative of one or more unknown insertion sites. hi2908 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040707-2 hi2911bTg This feature is representative of one or more unknown insertion sites. hi2911b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-6 hi2914Tg This feature is representative of one or more unknown insertion sites. hi2914 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040824-6 hi2933Tg This feature is representative of one or more unknown insertion sites. hi2933 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040315-4 hi2936Tg This feature is representative of one or more unknown insertion sites. hi2936 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040929-6 hi2937Tg This feature is representative of one or more unknown insertion sites. hi2937 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040824-16 hi2939Tg This feature is representative of one or more unknown insertion sites. hi2939 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040726-2 hi296aTg This feature is representative of one or more unknown insertion sites. hi296a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040713-2 hi296bTg This feature is representative of one or more unknown insertion sites. hi296b Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040824-8 hi2972bTg This feature is representative of one or more unknown insertion sites. hi2972b Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-84 hi297Tg This feature is representative of one or more unknown insertion sites. hi297 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040727-4 hi2991Tg This feature is representative of one or more unknown insertion sites. hi2991 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040715-14 hi2992Tg This feature is representative of one or more unknown insertion sites. hi2992 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-6 hi2993Tg This feature is representative of one or more unknown insertion sites. hi2993 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041011-12 hi2994Tg This feature is representative of one or more unknown insertion sites. hi2994 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040713-6 hi299Tg This feature is representative of one or more unknown insertion sites. hi299 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-980203-346 hi2Tg This feature is representative of one or more unknown insertion sites. hi2 Transgenic Insertion adult males treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(SFG) ZDB-TGCONSTRCT-070117-176 2019-09-17
ZDB-ALT-040825-12 hi3013Tg This feature is representative of one or more unknown insertion sites. hi3013 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040924-6 hi3017Tg This feature is representative of one or more unknown insertion sites. hi3017 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040825-14 hi3018aTg This feature is representative of one or more unknown insertion sites. hi3018a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040722-6 hi3018cTg This feature is representative of one or more unknown insertion sites. hi3018c Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040712-6 hi3020Tg This feature is representative of one or more unknown insertion sites. hi3020 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040719-14 hi3028Tg This feature is representative of one or more unknown insertion sites. hi3028 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040220-4 hi3068Tg This feature is representative of one or more unknown insertion sites. hi3068 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040825-16 hi3073Tg This feature is representative of one or more unknown insertion sites. hi3073 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041027-4 hi3074Tg This feature is representative of one or more unknown insertion sites. hi3074 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-8 hi3076Tg This feature is representative of one or more unknown insertion sites. hi3076 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-24 hi3079Tg This feature is representative of one or more unknown insertion sites. hi3079 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-16 hi307Tg This feature is representative of one or more unknown insertion sites. hi307 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040315-6 hi3081Tg This feature is representative of one or more unknown insertion sites. hi3081 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-14 hi3093Tg This feature is representative of one or more unknown insertion sites. hi3093 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-26 hi3096Tg This feature is representative of one or more unknown insertion sites. hi3096 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040825-18 hi3101Tg This feature is representative of one or more unknown insertion sites. hi3101 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040220-8 hi3112aTg This feature is representative of one or more unknown insertion sites. hi3112a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040825-20 hi3112bTg This feature is representative of one or more unknown insertion sites. hi3112b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-4 hi3118Tg This feature is representative of one or more unknown insertion sites. hi3118 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-28 hi3120Tg This feature is representative of one or more unknown insertion sites. hi3120 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050909-2 hi3147Tg This feature is representative of one or more unknown insertion sites. hi3147 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-6 hi3174aTg This feature is representative of one or more unknown insertion sites. hi3174a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-14 hi3181Tg This feature is representative of one or more unknown insertion sites. hi3181 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-40 hi318Tg This feature is representative of one or more unknown insertion sites. hi318 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040310-12 hi3198Tg This feature is representative of one or more unknown insertion sites. hi3198 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-16 hi319Tg This feature is representative of one or more unknown insertion sites. hi319 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040728-12 hi3202aTg This feature is representative of one or more unknown insertion sites. hi3202a Transgenic Insertion embryos treated with DNA The construct consists of two inserts, tail to tail (5'-3', 3'-5') inserted into a gene on the plus strand of the genome. Hopkins Lab ZDB-LAB-970424-15 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040929-8 hi3202bTg This feature is representative of one or more unknown insertion sites. hi3202b Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040312-6 hi3205Tg This feature is representative of one or more unknown insertion sites. hi3205 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040824-10 hi3208Tg This feature is representative of one or more unknown insertion sites. hi3208 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-10 hi3235Tg This feature is representative of one or more unknown insertion sites. hi3235 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-12 hi3237Tg This feature is representative of one or more unknown insertion sites. hi3237 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040130-8 hi3239Tg This feature is representative of one or more unknown insertion sites. hi3239 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040312-10 hi3245Tg This feature is representative of one or more unknown insertion sites. hi3245 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-10 hi3248Tg This feature is representative of one or more unknown insertion sites. hi3248 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040824-12 hi3263Tg This feature is representative of one or more unknown insertion sites. hi3263 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-14 hi3282Tg This feature is representative of one or more unknown insertion sites. hi3282 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040908-6 hi3290bTg This feature is representative of one or more unknown insertion sites. hi3290b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-14 hi3305Tg This feature is representative of one or more unknown insertion sites. hi3305 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040827-8 hi3308Tg This feature is representative of one or more unknown insertion sites. hi3308 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand.; The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-16 hi3332Tg This feature is representative of one or more unknown insertion sites. hi3332 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-18 hi3351Tg This feature is representative of one or more unknown insertion sites. hi3351 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040129-8 hi3357Tg This feature is representative of one or more unknown insertion sites. hi3357 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041005-6 hi3366Tg This feature is representative of one or more unknown insertion sites. hi3366 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040826-20 hi3378Tg This feature is representative of one or more unknown insertion sites. hi3378 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040827-10 hi3394aTg This feature is representative of one or more unknown insertion sites. hi3394a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-22 hi3400Tg This feature is representative of one or more unknown insertion sites. hi3400 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040713-10 hi340aTg This feature is representative of one or more unknown insertion sites. h340, hi340a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040713-12 hi340bTg This feature is representative of one or more unknown insertion sites. hi340b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040827-4 hi3417Tg This feature is representative of one or more unknown insertion sites. hi3417 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040723-10 hi3439Tg This feature is representative of one or more unknown insertion sites. hi3439 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040714-4 hi343Tg This feature is representative of one or more unknown insertion sites. hi343 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040827-14 hi3471Tg This feature is representative of one or more unknown insertion sites. hi3471 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040824-14 hi3475Tg This feature is representative of one or more unknown insertion sites. hi3475 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand.; The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-26 hi3479Tg This feature is representative of one or more unknown insertion sites. hi3479 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040716-4 hi3499Tg This feature is representative of one or more unknown insertion sites. hi3499 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-2 hi349Tg This feature is representative of one or more unknown insertion sites. hi349 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040930-16 hi3505Tg This feature is representative of one or more unknown insertion sites. hi3505 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand.; Could have been created with either the F5 or GT virus (more likely GT, but cannot be sure) Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040827-16 hi3510Tg This feature is representative of one or more unknown insertion sites. hi3510 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-10 hi3512bTg This feature is representative of one or more unknown insertion sites. hi3512b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-6 hi3512cTg This feature is representative of one or more unknown insertion sites. hi3512c Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-18 hi3526bTg This feature is representative of one or more unknown insertion sites. hi3526b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040220-12 hi3564Tg This feature is representative of one or more unknown insertion sites. hi3564 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-20 hi3580Tg This feature is representative of one or more unknown insertion sites. hi3580 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040929-10 hi3583Tg This feature is representative of one or more unknown insertion sites. hi3583 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-10 hi3593Tg This feature is representative of one or more unknown insertion sites. hi3593 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040713-22 hi3594aTg This feature is representative of one or more unknown insertion sites. hi3594a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-20 hi3619Tg This feature is representative of one or more unknown insertion sites. hi3619 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-2 hi3625aTg This feature is representative of one or more unknown insertion sites. hi3625a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040220-6 hi3627Tg This feature is representative of one or more unknown insertion sites. hi3627 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-12 hi3630aTg This feature is representative of one or more unknown insertion sites. hi3630a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040722-12 hi3632Tg This feature is representative of one or more unknown insertion sites. hi3632 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-18 hi3634Tg This feature is representative of one or more unknown insertion sites. hi3634 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand.; The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-14 hi3635Tg This feature is representative of one or more unknown insertion sites. hi3635 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040929-12 hi3639Tg This feature is representative of one or more unknown insertion sites. hi3639 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-24 hi3644Tg This feature is representative of one or more unknown insertion sites. hi3644 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040315-10 hi3649Tg This feature is representative of one or more unknown insertion sites. hi3649 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040723-12 hi3653bTg This feature is representative of one or more unknown insertion sites. hi3653b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-18 hi3655bTg This feature is representative of one or more unknown insertion sites. hi3655b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050908-8 hi3655dTg This feature is representative of one or more unknown insertion sites. hi3655d Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-6 hi3662Tg This feature is representative of one or more unknown insertion sites. hi3662 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-20 hi3663Tg This feature is representative of one or more unknown insertion sites. hi3663 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040907-8 hi3669Tg This feature is representative of one or more unknown insertion sites. hi3669 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040312-2 hi3678Tg This feature is representative of one or more unknown insertion sites. hi3678 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040929-14 hi3681Tg This feature is representative of one or more unknown insertion sites. hi3681 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-051213-2 hi3684Tg This feature is representative of one or more unknown insertion sites. hi3684 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-26 hi3685Tg This feature is representative of one or more unknown insertion sites. hi3685 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040719-10 hi3689Tg This feature is representative of one or more unknown insertion sites. hi3689 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-10 hi3709Tg This feature is representative of one or more unknown insertion sites. hi3709 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-6 hi3714Tg This feature is representative of one or more unknown insertion sites. hi3714 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040930-2 hi3721Tg This feature is representative of one or more unknown insertion sites. hi3721 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-8 hi3736aTg This feature is representative of one or more unknown insertion sites. hi3736a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-021125-2 hi3747Tg This feature is representative of one or more unknown insertion sites. hi3747 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand.; Could have been created with either the F5 or GT virus (more likely GT, but cannot be sure) Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-8 hi3764Tg This feature is representative of one or more unknown insertion sites. hi3764 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040923-4 hi3773Tg This feature is representative of one or more unknown insertion sites. hi3773 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-14 hi3783Tg This feature is representative of one or more unknown insertion sites. hi3783 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-18 hi3785Tg This feature is representative of one or more unknown insertion sites. hi3785 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-16 hi3789Tg This feature is representative of one or more unknown insertion sites. hi3789 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-62 hi37Tg This feature is representative of one or more unknown insertion sites. hi37 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-041001-16 hi3808Tg This feature is representative of one or more unknown insertion sites. hi3808 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-10 hi3812Tg This feature is representative of one or more unknown insertion sites. hi3812 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040831-10 hi3817Tg This feature is representative of one or more unknown insertion sites. hi3817 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040831-4 hi3820aTg This feature is representative of one or more unknown insertion sites. hi3820a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-12 hi3820bTg This feature is representative of one or more unknown insertion sites. hi3820b Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040721-8 hi3821Tg This feature is representative of one or more unknown insertion sites. hi3821 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-32 hi383aTg This feature is representative of one or more unknown insertion sites. hi383a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-090423-4 hi3883Tg This feature is representative of one or more unknown insertion sites. hi3883 Transgenic Insertion embryos treated with DNA This transgenic line is known to have more than one insertion linked to it's phenotype. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-10 hi3885Tg This feature is representative of one or more unknown insertion sites. hi3885 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-4 hi3890Tg This feature is representative of one or more unknown insertion sites. hi3890 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-14 hi3893Tg This feature is representative of one or more unknown insertion sites. hi3893 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040223-12 hi3911Tg This feature is representative of one or more unknown insertion sites. hi3911 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040312-8 hi3936Tg This feature is representative of one or more unknown insertion sites. hi3936 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040827-12 hi3959aTg This feature is representative of one or more unknown insertion sites. hi3959, hi3959Tg Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040310-16 hi3960Tg This feature is representative of one or more unknown insertion sites. hi3960 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041001-4 hi3970Tg This feature is representative of one or more unknown insertion sites. hi3970 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040310-8 hi3979Tg This feature is representative of one or more unknown insertion sites. hi3979 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040310-14 hi3986Tg This feature is representative of one or more unknown insertion sites. hi3986 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040723-14 hi3988Tg This feature is representative of one or more unknown insertion sites. hi3988 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-001221-6 hi399Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 4 Tg(SFG) ZDB-TGCONSTRCT-070117-176 2019-09-17
ZDB-ALT-040316-4 hi4003aTg This feature is representative of one or more unknown insertion sites. hi4003a Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand.; Could have been made with either the F5 or GT virus (more likely GT, but cannot be sure) Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040831-6 hi4026Tg This feature is representative of one or more unknown insertion sites. hi4026 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040315-8 hi4042Tg This feature is representative of one or more unknown insertion sites. hi4042 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040927-22 hi4049Tg This feature is representative of one or more unknown insertion sites. hi4049 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-050809-12 hi4050Tg This feature is representative of one or more unknown insertion sites. hi4050 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041026-2 hi4055Tg This feature is representative of one or more unknown insertion sites. hi4055 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040727-12 hi4063aTg This feature is representative of one or more unknown insertion sites. hi4063a Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040923-2 hi4063bTg This feature is representative of one or more unknown insertion sites. hi4063b Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040310-18 hi4070Tg This feature is representative of one or more unknown insertion sites. hi4070 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040714-8 hi409Tg This feature is representative of one or more unknown insertion sites. hi409 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-041011-10 hi4103Tg This feature is representative of one or more unknown insertion sites. hi4103 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041007-8 hi4131Tg This feature is representative of one or more unknown insertion sites. hi4131 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040831-8 hi4134Tg This feature is representative of one or more unknown insertion sites. hi4134 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040831-12 hi4153Tg This feature is representative of one or more unknown insertion sites. hi4153 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040831-2 hi4161aTg This feature is representative of one or more unknown insertion sites. hi4161a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040830-2 hi4166Tg This feature is representative of one or more unknown insertion sites. hi4166 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040915-10 hi4201bTg This feature is representative of one or more unknown insertion sites. hi4201b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040713-8 hi4205Tg This feature is representative of one or more unknown insertion sites. hi4205 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand.; Could have been created with either the F5 or GT virus (more likely GT, but cannot be sure) Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-106 hi428Tg This feature is representative of one or more unknown insertion sites. hi428 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-90 hi429Tg This feature is representative of one or more unknown insertion sites. hi429 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 13 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-64 hi43Tg This feature is representative of one or more unknown insertion sites. hi43 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-22 hi447Tg This feature is representative of one or more unknown insertion sites. hi447 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-70 hi459Tg This feature is representative of one or more unknown insertion sites. hi459 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040715-2 hi471Tg This feature is representative of one or more unknown insertion sites. hi471 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 9 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-72 hi472Tg This feature is representative of one or more unknown insertion sites. hi472 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-26 hi486Tg This feature is representative of one or more unknown insertion sites. hi486 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-48 hi491Tg This feature is representative of one or more unknown insertion sites. hi491 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-980203-304 hi4Tg This feature is representative of one or more unknown insertion sites. hi4 Transgenic Insertion adult males treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(SFG) ZDB-TGCONSTRCT-070117-176 2019-09-17
ZDB-ALT-020426-44 hi526aTg This feature is representative of one or more unknown insertion sites. hi526a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 14 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040715-8 hi526bTg This feature is representative of one or more unknown insertion sites. hi526b Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-58 hi528Tg This feature is representative of one or more unknown insertion sites. hi528 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-52 hi548Tg This feature is representative of one or more unknown insertion sites. hi548 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-88 hi550Tg This feature is representative of one or more unknown insertion sites. hi550 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040715-10 hi557Tg This feature is representative of one or more unknown insertion sites. hi557 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020430-54 hi558Tg This feature is representative of one or more unknown insertion sites. hi558 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040716-2 hi559Tg This feature is representative of one or more unknown insertion sites. hi559 Transgenic Insertion embryos treated with DNA The construct consists of two inserts, tail to tail (5'-3', 3'-5') inserted into a gene on the minus strand of the genome.; Retroviral insertion in the first intron of cdipt disrupting the PI synthase amino acid sequence near the amino terminus. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-104 hi572Tg This feature is representative of one or more unknown insertion sites. hi572 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020430-8 hi577aTg This feature is representative of one or more unknown insertion sites. hi577a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 4 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020430-48 hi577bTg This feature is representative of one or more unknown insertion sites. hi577b Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 15 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-12 hi591Tg This feature is representative of one or more unknown insertion sites. hi591 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020422-8 hi5Tg This feature is representative of one or more unknown insertion sites. hi5 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020430-50 hi601Tg This feature is representative of one or more unknown insertion sites. hi601 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-94 hi61Tg This feature is representative of one or more unknown insertion sites. hi61 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 23 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-74 hi63Tg This feature is representative of one or more unknown insertion sites. hi63 Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Chr: 21 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020430-30 hi642Tg This feature is representative of one or more unknown insertion sites. hi642 Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020430-40 hi688Tg This feature is representative of one or more unknown insertion sites. hi688 Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-38 hi694Tg This feature is representative of one or more unknown insertion sites. hi694 Transgenic Insertion DNA Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040217-10 hi780Tg This feature is representative of one or more unknown insertion sites. hi780 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040716-6 hi781Tg This feature is representative of one or more unknown insertion sites. hi781 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-36 hi783Tg This feature is representative of one or more unknown insertion sites. hi783 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020430-34 hi800aTg This feature is representative of one or more unknown insertion sites. hi800a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 7 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-60 hi80aTg This feature is representative of one or more unknown insertion sites. hi80a Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 5 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-92 hi821aTg This feature is representative of one or more unknown insertion sites. hi821a Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand.; Insertion within the second intron of the gene wdr43. Hopkins Lab ZDB-LAB-970424-15 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040217-20 hi821bTg This feature is representative of one or more unknown insertion sites. hi821b Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040719-2 hi823Tg This feature is representative of one or more unknown insertion sites. hi823 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040716-8 hi840Tg This feature is representative of one or more unknown insertion sites. hi840 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-050805-2 hi870Tg This feature is representative of one or more unknown insertion sites. hi870 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 18 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-54 hi887Tg This feature is representative of one or more unknown insertion sites. hi887 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-22 hi889Tg This feature is representative of one or more unknown insertion sites. hi889 Transgenic Insertion DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is also on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020301-2 hi891Tg This feature is representative of one or more unknown insertion sites. hi891 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(SFG) ZDB-TGCONSTRCT-070117-176 2019-09-17
ZDB-ALT-020426-82 hi904Tg This feature is representative of one or more unknown insertion sites. hi904 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-80 hi923Tg This feature is representative of one or more unknown insertion sites. hi923 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 2 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040719-4 hi929Tg This feature is representative of one or more unknown insertion sites. hi929 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040719-12 hi932Tg This feature is representative of one or more unknown insertion sites. hi932 Transgenic Insertion embryos treated with DNA The construct was inserted on the plus strand of the genome. The gene in which the insertion occurred is on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-041026-4 hi933Tg This feature is representative of one or more unknown insertion sites. hi933 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020430-28 hi954Tg This feature is representative of one or more unknown insertion sites. hi954 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-2 hi962Tg This feature is representative of one or more unknown insertion sites. hi962 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-040719-8 hi969Tg This feature is representative of one or more unknown insertion sites. hi969 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-86 hi96Tg This feature is representative of one or more unknown insertion sites. hi96 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 20 Tg(F5) ZDB-TGCONSTRCT-070117-174 2019-09-17
ZDB-ALT-020426-4 hi975Tg This feature is representative of one or more unknown insertion sites. hi975 Transgenic Insertion DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is on the plus strand. Hopkins Lab ZDB-LAB-970424-15 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-020426-102 hi994Tg This feature is representative of one or more unknown insertion sites. hi994 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-040720-6 hi998Tg This feature is representative of one or more unknown insertion sites. hi998 Transgenic Insertion embryos treated with DNA The construct was inserted on the minus strand of the genome. The gene in which the insertion occurred is also on the minus strand. Hopkins Lab ZDB-LAB-970424-15 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-150413-1 hjr1Tg Transgenic Insertion embryos treated with DNA Fish Reproduction ZDB-LAB-080521-1 Unmapped Tg(Oni.Fshb:EGFP,myl7:EGFP) ZDB-TGCONSTRCT-150413-1 2019-09-17
ZDB-ALT-150413-2 hjr2Tg Transgenic Insertion embryos treated with DNA Fish Reproduction ZDB-LAB-080521-1 Unmapped Tg(Oni.Lhb:mCherry,myl7:EGFP) ZDB-TGCONSTRCT-150413-2 2019-09-17
ZDB-ALT-150803-5 hjr3Tg Transgenic Insertion embryos treated with DNA The line expresses tagRFP in the LH gonadotropes of the pituitary. Fish Reproduction ZDB-LAB-080521-1 Unmapped Tg(Oni.Ihb:TagRFP-CAAX,myl7:mCherry) ZDB-TGCONSTRCT-150803-5 2019-09-17
ZDB-ALT-140217-7 hkb1Tg Transgenic Insertion embryos treated with DNA KL Yung Lab ZDB-LAB-130530-2 Unmapped Tg(th:GFP) ZDB-TGCONSTRCT-140217-7 2019-09-17
ZDB-ALT-140417-2 hki1Tg Transgenic Insertion embryos treated with DNA Panula Lab ZDB-LAB-970819-15 Unmapped Tg(pink1:EGFP) ZDB-TGCONSTRCT-140417-2 2019-09-17
ZDB-ALT-180816-1 hki2 Small Deletion embryos treated with CRISPR1-hrh3 A five-nucleotide deletion results in a frameshift after amino acid 133, and a premature stop codon at 312 amino acids, resulting in the loss of 5 of 7 transmembrane domains and the domain necessary for the constitutive activity of the receptor. Panula Lab ZDB-LAB-970819-15 Chr: 7 2019-09-17
ZDB-ALT-140911-6 hkk10Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg6(Xla.Eef1a1-ccnb1:TC-EGFP-STOP-ccnb1) ZDB-TGCONSTRCT-140911-6 2019-09-17
ZDB-ALT-120103-5 hkk1Tg Tg(Xla.Eef1a1-ccnb1:TC-EGFP-ccnb1)hkk1, zf251Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg(Xla.Eef1a1-ccnb1:TC-EGFP-STOP-ccnb1) ZDB-TGCONSTRCT-120103-5 2019-09-17
ZDB-ALT-120103-6 hkk2Tg Tg1(Xla.Eef1a1-UTR-ccnb1:TC-EGFP)hkk2, Tg(Xla.Eef1a1-1ccnb1:TC-EGFP)zf252, zf252Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg1(Xla.Eef1a1-UTR-ccnb1:TC-EGFP) ZDB-TGCONSTRCT-120103-6 2019-09-17
ZDB-ALT-120103-7 hkk3Tg Tg2(Xla.Eef1a1-UTR-ccnb1:TC-EGFP)hkk3, Tg(Xla.Eef1a1-2ccnb1:TC-EGFP)zf253, zf253Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg2(Xla.Eef1a1-UTR-ccnb1:TC-EGFP) ZDB-TGCONSTRCT-120103-7 2019-09-17
ZDB-ALT-140109-1 hkk4Tg Tg3(Xla.Eef1a1-UTR-ccnb1:TC-EGFP)hkk4 Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg3(Xla.Eef1a1-UTR-ccnb1:TC-EGFP) ZDB-TGCONSTRCT-131230-1 2019-09-17
ZDB-ALT-140911-1 hkk5Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg1(Xla.Eef1a1-ccnb1:TC-EGFP-STOP-ccnb1) ZDB-TGCONSTRCT-140911-1 2019-09-17
ZDB-ALT-140911-2 hkk6Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg2(Xla.Eef1a1-ccnb1:TC-EGFP-STOP-ccnb1) ZDB-TGCONSTRCT-140911-2 2019-09-17
ZDB-ALT-140911-3 hkk7Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg3(Xla.Eef1a1-ccnb1:TC-EGFP-STOP-ccnb1) ZDB-TGCONSTRCT-140911-3 2019-09-17
ZDB-ALT-140911-4 hkk8Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg4(Xla.Eef1a1-ccnb1:TC-EGFP-STOP-ccnb1) ZDB-TGCONSTRCT-140911-4 2019-09-17
ZDB-ALT-140911-5 hkk9Tg Transgenic Insertion embryos treated with DNA Kotani Lab ZDB-LAB-131220-1 Unmapped Tg5(Xla.Eef1a1-ccnb1:TC-EGFP-STOP-ccnb1) ZDB-TGCONSTRCT-140911-5 2019-09-17
ZDB-ALT-161018-5 hkz011tTg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(coro1a:DsRedx) ZDB-TGCONSTRCT-161018-4 2019-09-17
ZDB-ALT-161020-2 hkz013Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(Xla.Tubb2b:bcl2a) ZDB-TGCONSTRCT-161020-2 2019-09-17
ZDB-ALT-161018-6 hkz014tTg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(coro1a:Kaede) ZDB-TGCONSTRCT-161018-5 2019-09-17
ZDB-ALT-161018-7 hkz015tTg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(mpeg1.1:LOXP-DsRedx-LOXP-EGFP) ZDB-TGCONSTRCT-161018-6 2019-09-17
ZDB-ALT-180702-2 hkz016tTg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(lck:LOXP-DsRedx-LOXP-EGFP) ZDB-TGCONSTRCT-180702-3 2019-09-17
ZDB-ALT-180702-3 hkz017tTg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(LCR:LOXP-DsRedx-LOXP-EGFP) ZDB-TGCONSTRCT-180702-2 2019-09-17
ZDB-ALT-180817-1 hkz018Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg2(Xla.Tubb:DsRed) ZDB-TGCONSTRCT-180817-1 2019-09-17
ZDB-ALT-190906-2 hkz020Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(mfap4:EGFP) ZDB-TGCONSTRCT-190906-1 2019-09-17
ZDB-ALT-130826-3 hkz02tTg Tg(hsp70l:MYC-runx1)hkz02t Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(hsp70l:MYC-runx1) ZDB-TGCONSTRCT-130826-3 2019-09-17
ZDB-ALT-130125-2 hkz03tTg Tg(hsp70l:MYC-cmyb)hkz03t Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(hsp70l:MYC-myb) ZDB-TGCONSTRCT-130125-2 2019-09-17
ZDB-ALT-120810-3 hkz04tTg Tg(coro1a:EGFP)hkz04t Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(coro1a:EGFP) ZDB-TGCONSTRCT-120810-3 2019-09-17
ZDB-ALT-120810-4 hkz05tTg Tg(coro1a:EGFP)hkz05t Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(coro1a:EGFP) ZDB-TGCONSTRCT-120810-3 2019-09-17
ZDB-ALT-140130-1 hkz06tTg TgPAC(tal1:d2EGFP,tal1:DsRed)hkz06t Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped TgPAC(tal1:d2EGFP,tal1:DsRed) ZDB-TGCONSTRCT-140130-4 2019-09-17
ZDB-ALT-140130-2 hkz07tTg TgPAC(tal1:DsRed)hkz07t Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped TgPAC(tal1:DsRed) ZDB-TGCONSTRCT-140130-6 2019-09-17
ZDB-ALT-140130-3 hkz08tTg TgPAC(tal1:d2EGFP)hkz08t Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped TgPAC(tal1:d2EGFP) ZDB-TGCONSTRCT-140130-5 2019-09-17
ZDB-ALT-150729-1 hkz09tTg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg2(hsp70l:EGFP) ZDB-TGCONSTRCT-150729-1 2019-09-17
ZDB-ALT-110218-37 hkz1 rumba Point Mutation adult males treated with ENU Wen Lab ZDB-LAB-011010-6 Chr: 16 2019-09-17
ZDB-ALT-181210-2 hkz10 -4bp Small Deletion embryos treated with CRISPR1-csf1b Wen Lab ZDB-LAB-011010-6 Chr: 8 2019-09-17
ZDB-ALT-111025-1 hkz100Tg Tg(actc1b:Avi.aequorin-EGFP)hkz100 Transgenic Insertion embryos treated with DNA Laboratory of Dr. Andrew L. Miller ZDB-LAB-970424-45 Unmapped Tg(actc1b:AVI.aequorin,EGFP) ZDB-TGCONSTRCT-111025-1 2019-09-17
ZDB-ALT-150729-2 hkz10tTg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(hsp70l:il1b-EGFP) ZDB-TGCONSTRCT-150729-2 2019-09-17
ZDB-ALT-181210-3 hkz11 -4bp Small Deletion embryos treated with CRISPR1-il34 Wen Lab ZDB-LAB-011010-6 Chr: 18 2019-09-17
ZDB-ALT-160114-1 hkz12Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(coro1a:LOXP-DsRedx-LOXP-GFP) ZDB-TGCONSTRCT-160114-1 2019-09-17
ZDB-ALT-181207-7 hkz15Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(mpeg1.1:LOXP-DsRedx-LOXP-GFP) ZDB-TGCONSTRCT-181207-7 2019-09-17
ZDB-ALT-181207-8 hkz16Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(mpeg1.1:Kaede) ZDB-TGCONSTRCT-181207-8 2019-09-17
ZDB-ALT-181207-9 hkz17Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(Xla.Tubb:csf1a) ZDB-TGCONSTRCT-181207-9 2019-09-17
ZDB-ALT-181207-10 hkz18Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(Xla.Tubb:csf1b) ZDB-TGCONSTRCT-181207-10 2019-09-17
ZDB-ALT-181207-11 hkz19Tg Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(Xla.Tubb:il34) ZDB-TGCONSTRCT-181207-11 2019-09-17
ZDB-ALT-120228-1 hkz1tTg Tg(hsp70l:MYC-irf8)hkz1t Transgenic Insertion embryos treated with DNA Wen Lab ZDB-LAB-011010-6 Unmapped Tg(hsp70l:MYC-irf8) ZDB-TGCONSTRCT-120228-1 2019-09-17
ZDB-ALT-110218-38 hkz2 samba Point Mutation adult males treated with ENU Wen Lab ZDB-LAB-011010-6 Chr: 7 2019-09-17
ZDB-ALT-130204-1 hkz3 Point Mutation ENU Sequencing of the cmyb locus revealed a T-to-A splice mutation leading to a competitive splice acceptor. the cmyb transcript contained a 13 nucleotide insertion between exon 8 and exon 9. This mutation leads to a truncated c-Myb protein lacking the transactivation domain but retains the DNA-binding domain Wen Lab ZDB-LAB-011010-6 Chr: 23 2019-09-17
ZDB-ALT-140320-1 hkz4 G242D Point Mutation ENU G242D is a hypomorphic allele harboring a missense mutation that destabilized the protein and weakened overall activity. Wen Lab ZDB-LAB-011010-6 Chr: 7 2019-09-17
ZDB-ALT-121220-1 hkz5 tango Point Mutation ENU Wen Lab ZDB-LAB-011010-6 Chr: 15 2019-09-17
ZDB-ALT-170424-1 hkz7 sm1120, smu1120 Insertion adult males treated with ENU The truncated Cebpa protein lacks the C-terminus of bZIP domain. Wen Lab ZDB-LAB-011010-6 Chr: 7 2019-09-17
ZDB-ALT-160901-4 hkz8 116 Point Mutation adult males treated with ENU Wen Lab ZDB-LAB-011010-6 Chr: 21 2019-09-17
ZDB-ALT-181210-1 hkz9 +25 bp Insertion embryos treated with CRISPR1-csf1a Wen Lab ZDB-LAB-011010-6 Chr: 11 2019-09-17
ZDB-ALT-130625-2 hm13Tg Tg(actb2:Hsa.H2B-mCherry2)hm13 Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:Hsa.H2B-mCherry2) ZDB-TGCONSTRCT-130625-2 2019-09-17
ZDB-ALT-150209-2 hm15Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:hist2h2l-Citrine-AVI) ZDB-TGCONSTRCT-150209-1 2019-09-17
ZDB-ALT-110329-1 hm1Tg EMTB-3GFP, Tg(bactin2:Hsa.MAP7-EGFP)hm1, Tg(bactin2:HsENSCONSIN17-282-3xEGFP)hm1 Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:Hsa.MAP7-EGFP) ZDB-TGCONSTRCT-110329-1 2019-09-17
ZDB-ALT-130114-2 hm25Tg Tg(act2b:Hsa.H2B-Tomato)hm25 Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:Hsa.H2B-Tomato) ZDB-TGCONSTRCT-130114-1 2019-09-17
ZDB-ALT-130114-1 hm26Tg Tg(act2b:MA-Citrine)hm26 Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:MA-Citrine) ZDB-TGCONSTRCT-130114-2 2019-09-17
ZDB-ALT-130625-1 hm29Tg Tg(actb2:MA-mCherry2)hm29 Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:MA-mCherry2) ZDB-TGCONSTRCT-130625-1 2019-09-17
ZDB-ALT-150209-1 hm30Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:MA-Citrine) ZDB-TGCONSTRCT-130114-2 2019-09-17
ZDB-ALT-150209-3 hm31Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:Hsa.HIST1H2BJ-EGFP,actb2:MA-mCherry2) ZDB-TGCONSTRCT-150209-2 2019-09-17
ZDB-ALT-161213-1 hm32Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:MA-Citrine) ZDB-TGCONSTRCT-130114-2 2019-09-17
ZDB-ALT-161213-2 hm33Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:Hsa.H2B-Tomato) ZDB-TGCONSTRCT-130114-1 2019-09-17
ZDB-ALT-151109-2 hm34Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(hsp70l:Cerulean-Cre) ZDB-TGCONSTRCT-151109-2 2019-09-17
ZDB-ALT-181018-1 hm35Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(hsp70l:rac1a_T17N-2A-MA-mCherry2) ZDB-TGCONSTRCT-181018-1 2019-09-17
ZDB-ALT-181024-1 hm36Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:MA-MCardinal) ZDB-TGCONSTRCT-181022-2 2019-09-17
ZDB-ALT-181024-2 hm61Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(actb2:MA-MCardinal) ZDB-TGCONSTRCT-181022-2 2019-09-17
ZDB-ALT-151109-1 hm7Tg Transgenic Insertion embryos treated with DNA Megason Lab ZDB-LAB-080703-1 Unmapped Tg(elavl3:Cerulean-Cre) ZDB-TGCONSTRCT-151109-1 2019-09-17
ZDB-ALT-190408-3 hmr1 Small Deletion embryos treated with CRISPR1-tbx20 Longhou Fang Lab ZDB-LAB-190408-1 Chr: 16 2019-09-17
ZDB-ALT-190408-4 hmr2 Insertion embryos treated with CRISPR1-prok2 Longhou Fang Lab ZDB-LAB-190408-1 Chr: 6 2019-09-17
ZDB-ALT-190408-5 hmr3 Small Deletion embryos treated with CRISPR2-prokr1a Longhou Fang Lab ZDB-LAB-190408-1 Chr: 1 2019-09-17
ZDB-ALT-160811-1 hn1Tg Transgenic Insertion embryos treated with DNA Deng Lab ZDB-LAB-160805-1 Unmapped Tg4(myl7:EGFP) ZDB-TGCONSTRCT-160811-1 2019-09-17
ZDB-ALT-091027-19 hoxb1b_unrecovered un_hoxb1b, unrec_hoxb1b, unrecovered_hoxb1b Point Mutation adult males treated with ENU Chr: 12 2019-09-17
ZDB-ALT-190401-1 hsc102Tg Transgenic Insertion embryos treated with DNA Scott Laboratory ZDB-LAB-051026-1 Unmapped Tg(myl7:LOXP-STOP-LOXP-GFP) ZDB-TGCONSTRCT-190401-1 2019-09-17
ZDB-ALT-190910-2 hsc104Tg Transgenic Insertion embryos treated with DNA Scott Laboratory ZDB-LAB-051026-1 Unmapped Tg(en.epicon21:CreERT2) ZDB-TGCONSTRCT-190910-2 2019-09-17
ZDB-ALT-190903-3 hsc105Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:iCre,myl7:EGFP) ZDB-TGCONSTRCT-190903-5 2019-09-17
ZDB-ALT-190903-4 hsc106Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:iCre,myl7:EGFP) ZDB-TGCONSTRCT-190903-5 2019-09-17
ZDB-ALT-190903-5 hsc107Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(Xla.Cryg:LOXP-EGFP,foxj1a:ptk7a-LOXP-mCherry) ZDB-TGCONSTRCT-190903-6 2019-09-17
ZDB-ALT-190903-6 hsc108Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(Xla.Cryg:LOXP-EGFP,foxj1a:ptk7a-LOXP-mCherry) ZDB-TGCONSTRCT-190903-6 2019-09-17
ZDB-ALT-150714-2 hsc10Tg Transgenic Insertion embryos treated with DNA Scott Laboratory ZDB-LAB-051026-1 Unmapped Tg(hsp70l:med14,cryaa:EGFP) ZDB-TGCONSTRCT-150714-2 2019-09-17
ZDB-ALT-161123-3 hsc11 Small Deletion embryos treated with CRISPR1-mespaa Scott Laboratory ZDB-LAB-051026-1 Chr: 7 2019-09-17
ZDB-ALT-160719-1 hsc12Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:ptk7a,cryaa:EGFP) ZDB-TGCONSTRCT-160719-2 2019-09-17
ZDB-ALT-160719-2 hsc13Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:ptk7a,cryaa:EGFP) ZDB-TGCONSTRCT-160719-2 2019-09-17
ZDB-ALT-160719-3 hsc14Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:ptk7a,cryaa:EGFP) ZDB-TGCONSTRCT-160719-2 2019-09-17
ZDB-ALT-160719-4 hsc15Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:ptk7a,cryaa:EGFP) ZDB-TGCONSTRCT-160719-2 2019-09-17
ZDB-ALT-160719-5 hsc16Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:EGFP) ZDB-TGCONSTRCT-160719-1 2019-09-17
ZDB-ALT-160719-6 hsc17Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:EGFP) ZDB-TGCONSTRCT-160719-1 2019-09-17
ZDB-ALT-160719-7 hsc18Tg Transgenic Insertion embryos treated with DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(foxj1a:EGFP) ZDB-TGCONSTRCT-160719-1 2019-09-17
ZDB-ALT-190401-2 hsc25 Small Deletion embryos treated with CRISPR1-hey2 Scott Laboratory ZDB-LAB-051026-1 Chr: 20 2019-09-17
ZDB-ALT-190402-1 hsc27Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR1-hey2 Scott Laboratory ZDB-LAB-051026-1 Unmapped Tg(V5) ZDB-TGCONSTRCT-190402-1 2019-09-17
ZDB-ALT-190910-1 hsc28Tg Transgenic Insertion embryos treated with DNA Scott Laboratory ZDB-LAB-051026-1 Unmapped Tg(en.epicon21:EGFP) ZDB-TGCONSTRCT-190910-1 2019-09-17
ZDB-ALT-110222-3 hsc4Tg Tg(-0.8myl7:nlsDsRedExpress)hsc4 Transgenic Insertion embryos treated with DNA Scott Laboratory ZDB-LAB-051026-1 Unmapped Tg(-0.8myl7:NLS-DsRedx) ZDB-TGCONSTRCT-110222-3 2019-09-17
ZDB-ALT-100721-1 hsc5Tg Tg(actb2:Arl13b-GFP)hsc5, Tg(bactin2:Arl13b-GFP)hsc5 Transgenic Insertion DNA Ciruna Lab ZDB-LAB-060530-1 Unmapped Tg(actb2:Mmu.Arl13b-GFP) ZDB-TGCONSTRCT-100721-1 2019-09-17
ZDB-ALT-110523-1 hsc6Tg Tg(myl7:nlsKikGR)hsc6 Transgenic Insertion embryos treated with DNA Scott Laboratory ZDB-LAB-051026-1 Unmapped Tg(myl7:NLS-KikGR) ZDB-TGCONSTRCT-110523-1 2019-09-17
ZDB-ALT-110523-2 hsc7Tg Tg(kdrl:nlsKikGR)hsc7 Transgenic Insertion embryos treated with DNA Scott Laboratory ZDB-LAB-051026-1 Unmapped Tg(kdrl:NLS-KikGR) ZDB-TGCONSTRCT-110523-2 2019-09-17
ZDB-ALT-130506-1 hsc9 Small Deletion zinc finger nuclease This is a mutant allele harboring a 10 bp deletion that results in a frame shift and the incorporation of multiple premature termination codons. Ciruna Lab ZDB-LAB-060530-1 Chr: 22 2019-09-17
ZDB-ALT-190628-1 hsi101Tg Transgenic Insertion embryos treated with DNA Quinn Lab ZDB-LAB-190627-1 Unmapped Tg(myl7:Gth.Acr1-EGFP) ZDB-TGCONSTRCT-190628-1 2019-09-17
ZDB-ALT-140610-11 hsi1Tg Transgenic Insertion DNA Berman Lab ZDB-LAB-060914-1 Unmapped Tg(spi1b:LOXP-EGFP-LOXP-Hsa.NUP98-Hsa.HOXA9) ZDB-TGCONSTRCT-140610-10 2019-09-17
ZDB-ALT-150828-1 hsi2Tg Transgenic Insertion embryos treated with DNA Berman Lab ZDB-LAB-060914-1 Unmapped Tg(actb2:Hsa.KIT_D814V-2A-EGFP) ZDB-TGCONSTRCT-150828-1 2019-09-17
ZDB-ALT-170801-1 hsi3 Small Deletion embryos treated with CRISPR3-chd7 Berman Lab ZDB-LAB-060914-1 Ambiguous 2019-09-17
ZDB-ALT-170801-2 hsi4 Small Deletion embryos treated with CRISPR1-pycr1a Berman Lab ZDB-LAB-060914-1 Chr: 3 2019-09-17
ZDB-ALT-170801-3 hsi5 Indel embryos treated with CRISPR1-hace1 Berman Lab ZDB-LAB-060914-1 Chr: 16 2019-09-17
ZDB-ALT-190131-6 hsi6 R143H Complex embryos treated with CRISPR6-tp53 This line contains three separate point mutations. Berman Lab ZDB-LAB-060914-1 Chr: 5 2019-09-17
ZDB-ALT-190131-7 hsi7 R217H Complex embryos treated with CRISPR7-tp53 This line contains three separate point mutations. Berman Lab ZDB-LAB-060914-1 Chr: 5 2019-09-17
ZDB-ALT-190131-8 hsi8 G767S Complex embryos treated with CRISPR1-cdh5 This construct contains two separate mutations one 3 bp insertion/deletion and another point mutation. Berman Lab ZDB-LAB-060914-1 Chr: 7 2019-09-17
ZDB-ALT-190131-9 hsi9 R471W Complex embryos treated with CRISPR1-lmna This line contains two separate mutations. Berman Lab ZDB-LAB-060914-1 Chr: 16 2019-09-17
ZDB-ALT-060524-2 hspa9_unspecified un_hspa9, un_hspa9b, unspecified_hspa9 Unspecified Chr: 14 2019-09-17
ZDB-ALT-160722-1 hu10012 Small Deletion embryos treated with TALEN1-nrp1a Frameshift mutation at amino acid 96, caused by an 11 bp deletion, resulting in a stop codon at amino acid 133 Schulte-Merker ZDB-LAB-050429-4 Chr: 24 2019-09-17
ZDB-ALT-180702-6 hu10018Tg Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped TgBAC(isl1:GAL4FF) ZDB-TGCONSTRCT-121204-1 2019-09-17
ZDB-ALT-150727-4 hu10049Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(dll4:GAL4FF) ZDB-TGCONSTRCT-150727-4 2019-09-17
ZDB-ALT-150506-1 hu10125 Point Mutation adult males treated with ENU Sequencing of cad identified a mutation substituting a onserved residue in the linker region of the protein (P1850T). Schulte-Merker ZDB-LAB-050429-4 Chr: 20 2019-09-17
ZDB-ALT-140522-3 hu10320 Insertion embryos treated with TALEN1-sox18 van Impel et al (2014): 1 bp insertion 5′ to the HMG-box encoding sequence. This allele is predicted to encode a truncated protein that contains neither the essential HMG nor the trans-activation domains. No alternative transcripts could be detected in mutants. Schulte-Merker ZDB-LAB-050429-4 Chr: 23 2019-09-17
ZDB-ALT-140522-2 hu10330 Insertion embryos treated with TALEN1-nr2f2 van Impel et al. (2014): \nTALEN targeted the first exon of nr2f2 and generated a 1 bp insertion allele nr2f2^hu10330. Sequencing of\ncDNA from hu10330 mutant embryos did not reveal alternative transcripts lacking the 1 bp insertion.\nThe insertion resulted in a frame-shift and premature stop codon 5′ to both the nuclear receptor-DNA-binding domain and the ligand-binding domain. Schulte-Merker ZDB-LAB-050429-4 Chr: 18 2019-09-17
ZDB-ALT-170117-9 hu10414 Small Deletion embryos treated with TALEN1-ctnna1 premature stop codon after Threonine37, which resides 5′ to the β-catenin-binding domain and actin-binding domain. Bakkers Lab ZDB-LAB-031010-1 Chr: 24 2019-09-17
ZDB-ALT-160428-1 hu10478 Small Deletion embryos treated with CRISPR1-cfap53 7 bp deletion in exon 2, resulting in a frame shift that creates a premature stop codon at amino acid 60. Homozygotes are adult viable. Bakkers Lab ZDB-LAB-031010-1 Chr: 21 2019-09-17
ZDB-ALT-160721-18 hu10535 Small Deletion embryos treated with TALEN1-mmp2 Frameshift at aa 5; additional 1 aa then stop. Schulte-Merker ZDB-LAB-050429-4 Chr: 7 2019-09-17
ZDB-ALT-161128-2 hu10539 Small Deletion embryos treated with TALEN1-fam222bb Schulte-Merker ZDB-LAB-050429-4 Chr: 15 2019-09-17
ZDB-ALT-190308-1 hu10742 Pln_ZF.R14Del Small Deletion embryos treated with CRISPR1-pln Bakkers Lab ZDB-LAB-031010-1 Chr: 20 2019-09-17
ZDB-ALT-161128-3 hu10755 Indel embryos treated with TALEN1-fam222ba Schulte-Merker ZDB-LAB-050429-4 Chr: 5 2019-09-17
ZDB-ALT-180425-1 hu10818 Δ8B Small Deletion embryos treated with TALEN1-vcla This line is maintained by the Huveneer Lab ZDB-LAB-180424-2 Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-170620-10 hu10963 Small Deletion embryos treated with TALEN1-itga9 Schulte-Merker ZDB-LAB-050429-4 Chr: 13 2019-09-17
ZDB-ALT-160721-31 hu10965 Small Deletion embryos treated with TALEN1-ccbe1 Frameshift at aa 23; additional 8 aa then stop. Schulte-Merker ZDB-LAB-050429-4 Chr: 21 2019-09-17
ZDB-ALT-150528-1 hu10967Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(abcc6a:GAL4FF) ZDB-TGCONSTRCT-150528-1 2019-09-17
ZDB-ALT-161122-14 hu11433 Insertion embryos treated with CRISPR1-gnb5a Bakkers Lab ZDB-LAB-031010-1 Chr: 25 2019-09-17
ZDB-ALT-161122-15 hu11443 Indel embryos treated with CRISPR1-gnb5b Bakkers Lab ZDB-LAB-031010-1 Chr: 18 2019-09-17
ZDB-ALT-190211-5 hu11688Tg Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped Tg(myl7:VSFP) ZDB-TGCONSTRCT-190211-1 2019-09-17
ZDB-ALT-181004-2 hu11828Tg Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped Tg(7xTCF-Xla.Sia:NLS-mCherry) ZDB-TGCONSTRCT-110113-2 2019-09-17
ZDB-ALT-190308-3 hu11838 Abcc9_ZF.G989E Complex embryos treated with CRISPR1-abcc9 This mutant line contains two point mutations, one a SNP change and the other a change in the PAM site targeted by the CRISPR. Bakkers Lab ZDB-LAB-031010-1 Chr: 4 2019-09-17
ZDB-ALT-190308-2 hu11859 Abcc9_ZF.C1043Y Complex embryos treated with CRISPR2-abcc9 This mutant line contains two point mutations, one a SNP change and the other a change in the PAM site targeted by the CRISPR Bakkers Lab ZDB-LAB-031010-1 Chr: 4 2019-09-17
ZDB-ALT-190307-6 hu11872 Kcnj8_ZF.V65M Point Mutation Bakkers Lab ZDB-LAB-031010-1 Chr: 4 2019-09-17
ZDB-ALT-100813-4 hu119 hu119-02 Point Mutation adult males treated with ENU Tessadori et al (2015): single nucleotide substitution in furinA (G to A) resulting in a tryptophan (Trp) to stop (TAG) mutation at amino acid 411, resulting in a premature truncation of the FurinA subtilisin-like proprotein convertase Bakkers Lab ZDB-LAB-031010-1 Chr: 7 2019-09-17
ZDB-ALT-080910-2 hu1435 Point Mutation adult males treated with ENU den Hertog Lab ZDB-LAB-040713-1 Chr: 12 2019-09-17
ZDB-ALT-080728-1 hu1602 Point Mutation adult males treated with ENU Mutation of the splice donor from GT to AT results in the insertion of an 81 bp intron into the transcript, and the expansion of the second extracellular loop of the protein by 27 amino acids.; generated in the van Eeden lab Hubrecht Institute ZDB-LAB-141201-1 Chr: 2 2019-09-17
ZDB-ALT-110210-1 hu1667 Point Mutation This mutation causes a CAG to to TAG resulting in a Q982STOP substitution. Schulte-Merker ZDB-LAB-050429-4 Chr: 5 2019-09-17
ZDB-ALT-110920-1 hu1795 C54X Point Mutation ENU hu1795 is a cytosine to adenine mutation at nucleotide position 162 of the cx55.5 coding sequence. This nucleotide substitution results in a premature stop codon at amino acid position 54, where a cysteine residue is present in wild-type zebrafish. Based on te predicted membrane topology, only one of the four transmembrane domains should be translated in the mutant. Zebrafish homozygous for this mutation can be considered Cx55.5 knock-outs.
Klaassen et al. (2011) Hubrecht Institute ZDB-LAB-141201-1 Unmapped 2019-09-17
ZDB-ALT-180814-2 hu1798 Point Mutation adult males treated with ENU Missense mutation H239Q caused by an A>T substitution in exon 5 Schulte-Merker ZDB-LAB-050429-4 Chr: 19 2019-09-17
ZDB-ALT-081104-1 hu1811 Point Mutation ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 13 2019-09-17
ZDB-ALT-081104-2 hu1844 Point Mutation Cuppen Lab ZDB-LAB-070815-1 Chr: 21 2019-09-17
ZDB-ALT-080910-1 hu1864 Point Mutation adult males treated with ENU den Hertog Lab ZDB-LAB-040713-1 Chr: 17 2019-09-17
ZDB-ALT-090129-4 hu1886 Point Mutation ENU Exon donor site exon 5 G to A mutation, deletion of exon 5. Cuppen Lab ZDB-LAB-070815-1 Chr: 12 2019-09-17
ZDB-ALT-070622-1 hu1919 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 13 2019-09-17
ZDB-ALT-110630-21 hu1960 Y245 Point Mutation adult males treated with ENU A C-to-A substitution leads to a premature stop codon in the kinase domain. Clevers Lab ZDB-LAB-031201-2 Chr: 2 2019-09-17
ZDB-ALT-110630-22 hu1968 Y260 Point Mutation adult males treated with ENU A T-to-G substitution leads to a premature stop codon in the kinase domain. Clevers Lab ZDB-LAB-031201-2 Chr: 2 2019-09-17
ZDB-ALT-090610-6 hu1999 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 25 2019-09-17
ZDB-ALT-100813-3 hu202 hu202-04 Unknown adult males treated with ENU Bakkers Lab ZDB-LAB-031010-1 Unmapped 2019-09-17
ZDB-ALT-070315-6 hu2022 hu2022, hu2202 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 4 2019-09-17
ZDB-ALT-070315-8 hu2023 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 25 2019-09-17
ZDB-ALT-070315-9 hu2024 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 25 2019-09-17
ZDB-ALT-080229-1 hu2041 Point Mutation adult males treated with ENU Hinits et al. (2009. Development 136:403-414) report that sequencing the hu20141 allele identified a C to T transition, which results in a stop codon in the basic domain (CGA ->TGA). The mutation and flanking sequence are: AACGGAAATCTGCTCCTACTGACCGGCGAAAGGCCGCCACTTTGAGAGAA[C/T]GAAGGCGGCTCAAAAAGATCAACGAAGCT
TTTGACGCGCTAAAGAAAAAG Hubrecht Institute ZDB-LAB-141201-1 Chr: 4 2019-09-17
ZDB-ALT-090611-2 hu2081 Point Mutation ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 6 2019-09-17
ZDB-ALT-090424-2 hu2087 Point Mutation embryos treated with ENU Ketting Lab ZDB-LAB-090422-1 Chr: 5 2019-09-17
ZDB-ALT-070427-14 hu2098 hcrtr 168 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-070927-5 hu2107 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-100412-4 hu2115 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 11 2019-09-17
ZDB-ALT-090611-1 hu2117 Point Mutation ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 6 2019-09-17
ZDB-ALT-120725-1 hu2124 Point Mutation adult males treated with ENU hu2124 allele contains a C>A transition at position 185, resulting in a premature stop codon (TCG(S)>TAG/(stop)). her1hu2124 is truncated within the loop located at the end of exon 2. den Hertog Lab ZDB-LAB-040713-1 Chr: 5 2019-09-17
ZDB-ALT-071108-6 hu2127 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 24 2019-09-17
ZDB-ALT-071108-4 hu2131 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 9 2019-09-17
ZDB-ALT-090611-3 hu2132 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 6 2019-09-17
ZDB-ALT-070914-4 hu2162 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 24 2019-09-17
ZDB-ALT-070315-13 hu2163 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 2 2019-09-17
ZDB-ALT-070315-11 hu2164 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-070315-10 hu2165 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 4 2019-09-17
ZDB-ALT-080610-13 hu2173 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 1 2019-09-17
ZDB-ALT-090611-5 hu2184 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 24 2019-09-17
ZDB-ALT-080124-2 hu2410 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 8 2019-09-17
ZDB-ALT-070403-6 hu2479 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 8 2019-09-17
ZDB-ALT-090611-4 hu2483 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 24 2019-09-17
ZDB-ALT-100317-3 hu2484 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 19 2019-09-17
ZDB-ALT-081104-3 hu2485 Point Mutation Cuppen Lab ZDB-LAB-070815-1 Chr: 12 2019-09-17
ZDB-ALT-110825-7 hu2487 Point Mutation adult males treated with ENU Mutation: T > A. Nonsense. Cuppen Lab ZDB-LAB-070815-1 Chr: 12 2019-09-17
ZDB-ALT-071108-2 hu2504 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 20 2019-09-17
ZDB-ALT-090612-1 hu2525 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 6 2019-09-17
ZDB-ALT-070315-5 hu2526 Point Mutation adult males treated with ENU hu2526 contains an A>T transition at position 208, resulting in a premature stop codon (AAA(K)>TAA/(stop). her7hu2526 is truncated within HelixI of the HLH-domain located in exon 2. Hubrecht Institute ZDB-LAB-141201-1 Chr: 5 2019-09-17
ZDB-ALT-130220-3 hu2547 Point Mutation adult males treated with ENU The mutation in hu2547 was localized to exon 5 where it induced a point mutation resulting in a premature stop codon by exchanging a guanine to thymine in the codon that in normal cases codes for glutamic acid. The truncated protein in the mutants lacks the proteolytic site of PSEN1 and the C terminus. Cuppen Lab ZDB-LAB-070815-1 Chr: 17 2019-09-17
ZDB-ALT-110825-4 hu2548 Point Mutation adult males treated with ENU Mutation: T > A. Nonsense. Cuppen Lab ZDB-LAB-070815-1 Chr: 17 2019-09-17
ZDB-ALT-080916-1 hu255H Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 7 2019-09-17
ZDB-ALT-070315-3 hu2570 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 17 2019-09-17
ZDB-ALT-080124-1 hu2571 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 14 2019-09-17
ZDB-ALT-090611-7 hu2787 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 14 2019-09-17
ZDB-ALT-170608-20 hu2790 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 6 2019-09-17
ZDB-ALT-070720-3 hu2843 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 24 2019-09-17
ZDB-ALT-070315-12 hu2846 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Ambiguous 2019-09-17
ZDB-ALT-070323-1 hu2847 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 18 2019-09-17
ZDB-ALT-070323-2 hu2848 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 18 2019-09-17
ZDB-ALT-070730-10 hu2849 Point Mutation adult males treated with ENU Point mutation is IVS43+1 G>A, a mutation in the canonical splice donor site predicted to abolish splicing of exon 43. Hubrecht Institute ZDB-LAB-141201-1 Ambiguous 2019-09-17
ZDB-ALT-070924-2 hu2897 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-090611-6 hu2898 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 14 2019-09-17
ZDB-ALT-070927-3 hu2965 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 24 2019-09-17
ZDB-ALT-070927-4 hu2966 Point Mutation adult males treated with ENU No gross morphological or behavioral phenotypes during the first five days of development. All larvae fill swim bladder. Hubrecht Institute ZDB-LAB-141201-1 Chr: 24 2019-09-17
ZDB-ALT-100514-17 hu2971 Point Mutation adult males treated with ENU point-mutation leading to predicted premature stop-codon after amino acid 78 in efnb2b Hubrecht Institute ZDB-LAB-141201-1 Chr: 1 2019-09-17
ZDB-ALT-070321-9 hu2986 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 6 2019-09-17
ZDB-ALT-100412-2 hu2987 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-070321-8 hu2989 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 1 2019-09-17
ZDB-ALT-100813-2 hu304 hu304-10 Unknown adult males treated with ENU Bakkers Lab ZDB-LAB-031010-1 Unmapped 2019-09-17
ZDB-ALT-070315-1 hu3072 Point Mutation adult males treated with ENU The allele carries a C1568T change, which causes a premature termination of translation (R398>STOP). Cuppen Lab ZDB-LAB-070815-1 Chr: 22 2019-09-17
ZDB-ALT-090424-1 hu3173 Point Mutation embryos treated with ENU Ketting Lab ZDB-LAB-090422-1 Chr: 5 2019-09-17
ZDB-ALT-100506-16 hu3237 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 17 2019-09-17
ZDB-ALT-110113-4 hu3238 Point Mutation adult males treated with ENU Cytosine-to-thymine substitution in the second exon of the HMG-box of tcf7, which creates a premature stop codon. Clevers Lab ZDB-LAB-031201-2 Chr: 21 2019-09-17
ZDB-ALT-110906-3 hu3259 Point Mutation hu3259 has a nonsense mutation in exon 5 of gnl3 (ns, nucleostemin), resulting in a premature stop codon corresponding to a glutamic acid in position 117.
Paridaen et al. 2011 Clevers Lab ZDB-LAB-031201-2 Chr: 11 2019-09-17
ZDB-ALT-071108-7 hu3263 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-080814-9 hu3264 huW671X Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 8 2019-09-17
ZDB-ALT-100514-20 hu3278 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 14 2019-09-17
ZDB-ALT-070322-2 hu3279 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 8 2019-09-17
ZDB-ALT-070322-3 hu3280 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 8 2019-09-17
ZDB-ALT-090612-2 hu3281 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 18 2019-09-17
ZDB-ALT-090611-8 hu3283 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 14 2019-09-17
ZDB-ALT-071126-2 hu3284 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 6 2019-09-17
ZDB-ALT-070921-3 hu3286 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 4 2019-09-17
ZDB-ALT-070921-2 hu3292 Point Mutation adult males treated with ENU Stemple Lab ZDB-LAB-050412-2 Chr: 6 2019-09-17
ZDB-ALT-070322-1 hu3302 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Ambiguous 2019-09-17
ZDB-ALT-100506-2 hu3319 Point Mutation adult males treated with ENU Nonsense mutation that results in a premature stop codon (C40*). Cuppen Lab ZDB-LAB-070815-1 Chr: 1 2019-09-17
ZDB-ALT-070924-1 hu3328 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 14 2019-09-17
ZDB-ALT-100506-5 hu3329 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 10 2019-09-17
ZDB-ALT-100723-4 hu3332 Point Mutation adult males treated with ENU bace2 mutants carry a C to A mutation that leads to an early stop and results in a truncated Bace2 protein. Hubrecht Institute ZDB-LAB-141201-1 Chr: 15 2019-09-17
ZDB-ALT-100728-1 hu3334 Point Mutation adult males treated with ENU The allele has a TTG to TAG codon change resulting in a L133X premature stop. den Hertog Lab ZDB-LAB-040713-1 Chr: 21 2019-09-17
ZDB-ALT-080523-3 hu3335 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 22 2019-09-17
ZDB-ALT-080610-12 hu3336 Point Mutation adult males treated with ENU No gross morphological or behavioral phenotypes during the first five days of development. All larvae fill swim bladder. Hubrecht Institute ZDB-LAB-141201-1 Chr: 14 2019-09-17
ZDB-ALT-090610-2 hu3337 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 8 2019-09-17
ZDB-ALT-100514-18 hu3378 Unknown adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 5 2019-09-17
ZDB-ALT-071108-3 hu3392 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 23 2019-09-17
ZDB-ALT-080523-2 hu3393 Point Mutation adult males treated with ENU point-mutation leading to predicted premature stop-codon after amino acid 86 in
efnb2a Stemple Lab ZDB-LAB-050412-2 Chr: 9 2019-09-17
ZDB-ALT-080229-2 hu3395 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 22 2019-09-17
ZDB-ALT-080610-11 hu3425 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Ambiguous 2019-09-17
ZDB-ALT-080814-8 hu3426 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 1 2019-09-17
ZDB-ALT-080610-10 hu3427 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 11 2019-09-17
ZDB-ALT-080610-9 hu3429 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 19 2019-09-17
ZDB-ALT-080806-3 hu3430 Point Mutation adult males treated with ENU This telomerase mutant line carries a T->A change in the second exon of the
tert gene giving rise to an early stop codon. Hubrecht Institute ZDB-LAB-141201-1 Chr: 19 2019-09-17
ZDB-ALT-100723-5 hu3445 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 5 2019-09-17
ZDB-ALT-140805-1 hu3459 Point Mutation adult males treated with ENU Bonetti et al (2014)\nnonsense mutation in exon 3 of ptpn11a introducing a premature stop well upstream of the phosphatase catalytic site and hence, no functional protein is produced. den Hertog Lab ZDB-LAB-040713-1 Chr: 10 2019-09-17
ZDB-ALT-070403-5 hu3475 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 23 2019-09-17
ZDB-ALT-070403-7 hu3476 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 16 2019-09-17
ZDB-ALT-100317-6 hu3495 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 6 2019-09-17
ZDB-ALT-120314-1 hu3510 Point Mutation ENU Schulte-Merker ZDB-LAB-050429-4 Chr: 7 2019-09-17
ZDB-ALT-090610-3 hu3513 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 5 2019-09-17
ZDB-ALT-091001-3 hu3514 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 21 2019-09-17
ZDB-ALT-071108-5 hu3519 Point Mutation adult males treated with ENU No gross morphological or behavioral phenotypes during the first five days of development. All larvae fill swim bladder. Hubrecht Institute ZDB-LAB-141201-1 Chr: 2 2019-09-17
ZDB-ALT-070914-3 hu3520 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 23 2019-09-17
ZDB-ALT-080829-1 hu3525 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 9 2019-09-17
ZDB-ALT-070914-2 hu3526 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 17 2019-09-17
ZDB-ALT-090610-7 hu3528 Point Mutation adult males treated with ENU Homozygous viable. hu3528 is a T>A mutation in exon 8 of zebrafish mfn2. The mutation leads to the introduction of a stop codon at leucine 285 (MFN2 L285X), which truncates the protein after the GTPase domain thus removing the transmembrane domain essential for mitochondrial fusion, and therefore produces an Mfn2 protein that is predicted to be non-functional. Hubrecht Institute ZDB-LAB-141201-1 Chr: 8 2019-09-17
ZDB-ALT-070914-1 hu3530 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 16 2019-09-17
ZDB-ALT-100504-2 hu3534 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 1 2019-09-17
ZDB-ALT-080819-3 hu3536 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 12 2019-09-17
ZDB-ALT-100506-26 hu3554 Point Mutation adult males treated with ENU Stemple Lab ZDB-LAB-050412-2 Chr: 8 2019-09-17
ZDB-ALT-081019-1 hu3559 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 11 2019-09-17
ZDB-ALT-090611-11 hu3565 Point Mutation adult males treated with ENU No gross morphological or behavioral phenotypes during the first five days of development. All larvae fill swim bladder. Hubrecht Institute ZDB-LAB-141201-1 Chr: 23 2019-09-17
ZDB-ALT-080814-10 hu3567 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 2 2019-09-17
ZDB-ALT-130729-6 hu3568 Point Mutation adult males treated with ENU hu3568 carries a threonine to alanine point mutation in myd88 creating a premature stop codon. The mutation is located in the N-terminal death domain, leading to a truncated protein, lacking part of its death domain required for interaction with Irak4. The truncated protein is also missing the complete C-terminal TIR domain required for interaction with the cytoplasmic TIR domain of TLRs. Suspected null allele. Homozygotes showed no developmental differences compared with their wild-type siblings and could only be distinguished by genotyping.
Reference: van der Vaart et al. (2013) Cuppen Lab ZDB-LAB-070815-1 Chr: 24 2019-09-17
ZDB-ALT-080610-8 hu3569 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-080610-6 hu3575 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 6 2019-09-17
ZDB-ALT-090610-4 hu3580 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 5 2019-09-17
ZDB-ALT-080610-7 hu3581 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 16 2019-09-17
ZDB-ALT-091001-2 hu3582 Unknown adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 21 2019-09-17
ZDB-ALT-100504-6 hu3583 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 5 2019-09-17
ZDB-ALT-110825-5 hu3586 Point Mutation adult males treated with ENU Mutation: A > T. Nonsense. Cuppen Lab ZDB-LAB-070815-1 Chr: 6 2019-09-17
ZDB-ALT-100406-1 hu3587 Point Mutation adult males treated with ENU This allele has a single T>A base pair change that encodes an in-frame stop codon in exon 11. Hubrecht Institute ZDB-LAB-141201-1 Chr: 17 2019-09-17
ZDB-ALT-090608-1 hu3611 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 5 2019-09-17
ZDB-ALT-090221-1 hu3612 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 17 2019-09-17
ZDB-ALT-090506-1 hu3613 fof, full of fluid Point Mutation This is a D162E mutation in the EGF domain. Schulte-Merker ZDB-LAB-050429-4 Chr: 21 2019-09-17
ZDB-ALT-100412-1 hu3625 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 17 2019-09-17
ZDB-ALT-100317-5 hu3691 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 13 2019-09-17
ZDB-ALT-110916-1 hu3701 recq15 Unknown adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Unmapped 2019-09-17
ZDB-ALT-130410-7 hu3718 nob Point Mutation Sequencing of the entpd5a gene revealed a premature stop codon in the mutant allele due to a T to A transversion in the third coding exon resulting in a Leu to stop alteration at position 155, which is in the second apyrase conserved domain. Schulte-Merker ZDB-LAB-050429-4 Chr: 17 2019-09-17
ZDB-ALT-080610-5 hu3857 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 23 2019-09-17
ZDB-ALT-110713-1 hu4008Tg bglap:EGFP, osc:GFP, Tg(Ola.osteocalcin:EGFP)hu4008 Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg1(Ola.Bglap:EGFP) ZDB-TGCONSTRCT-110713-1 2019-09-17
ZDB-ALT-110802-2 hu4087 hu305, lin, linkspoot Point Mutation adult males treated with ENU Mutation: missense (T to G at bp 1538; amino acid position L337R) Bakkers Lab ZDB-LAB-031010-1 Chr: 13 2019-09-17
ZDB-ALT-190813-2 hu4140 Point Mutation adult males treated with ENU Schulte-Merker ZDB-LAB-050429-4 Unmapped 2019-09-17
ZDB-ALT-160707-13 hu4145 Point Mutation Schulte-Merker ZDB-LAB-050429-4 Chr: 10 2019-09-17
ZDB-ALT-060825-34 hu418b Point Mutation adult males treated with ENU Amino acid 295 of the zebrafish protein corresponds to amino acid 303 of the human ortholog. Hubrecht Institute ZDB-LAB-141201-1 Chr: 1 2019-09-17
ZDB-ALT-090507-1 hu4453Tg Tg(stab1l:YFP)hu4453, Tg(stabilin1:YFP) Transgenic Insertion DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(stab1:YFP) ZDB-TGCONSTRCT-090507-1 2019-09-17
ZDB-ALT-130411-3 hu4581 dragonfish Point Mutation Sequence analysis revealed a mutation in the splice acceptor site before exon 11 of the enpp1 gene resulting in a 5 bp deletion in the transcript and a predicted stop codon after 23 amino acids. Schulte-Merker ZDB-LAB-050429-4 Chr: 20 2019-09-17
ZDB-ALT-100205-1 hu4602 expando Point Mutation The point mutation is predicted to change a conserved isoleucine residue into a serine at position 1042 in the split kinase domain. Schulte-Merker ZDB-LAB-050429-4 Chr: 14 2019-09-17
ZDB-ALT-090506-3 hu4624Tg Tg(flt1:YFP)hu4624 Transgenic Insertion DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(flt1:YFP) ZDB-TGCONSTRCT-090506-1 2019-09-17
ZDB-ALT-170620-11 hu4767 Ly02-512 Point Mutation adult males treated with ENU Schulte-Merker ZDB-LAB-050429-4 Chr: 7 2019-09-17
ZDB-ALT-110802-3 hu4800 wickham, wkm Point Mutation adult males treated with ENU GTG>GAG, at 1277bp from the predicted start ATG Bakkers Lab ZDB-LAB-031010-1 Chr: 5 2019-09-17
ZDB-ALT-100208-1 hu4881Tg Tg(flt4:YFP)hu4881 Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(flt4:YFP) ZDB-TGCONSTRCT-100208-1 2019-09-17
ZDB-ALT-150601-6 hu4958 grt Point Mutation This is a T to G mutation in the abcc6a gene resulting in a L1429R substitution in a highly conserved regon of NBD-2 containing the Walker B motif. Schulte-Merker ZDB-LAB-050429-4 Chr: 6 2019-09-17
ZDB-ALT-040611-2 hu499 Point Mutation ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 21 2019-09-17
ZDB-ALT-140903-2 hu5055 Point Mutation Le Guen (2014): missense mutation the vegfc gene, changing a cysteine into an arginine residue (C365R) in the highly conserved C-terminal propeptide Schulte-Merker ZDB-LAB-050429-4 Chr: 1 2019-09-17
ZDB-ALT-110511-1 hu5088 Point Mutation ENU Schulte-Merker ZDB-LAB-050429-4 Chr: 14 2019-09-17
ZDB-ALT-141009-1 hu5142 Point Mutation embryos treated with ENU Line carries F138C caused by a TTC->TGC mutation. Schulte-Merker ZDB-LAB-050429-4 Chr: 1 2019-09-17
ZDB-ALT-130410-8 hu5310 nob Point Mutation This allele contained an A to G transversion in the first coding exon resulting in a Thr to Ala alteration at position 80. This mutation is located in a highly conserved amino acid residue of the first apyrase conserved domain. Schulte-Merker ZDB-LAB-050429-4 Chr: 17 2019-09-17
ZDB-ALT-110504-1 hu5333Tg flt1-enh:RFP, Tg(-0.8flt1:RFP)hu5333 Transgenic Insertion embryos treated with DNA Transgene shows strong expression in arterial intersegmental vessels, weak expression in venous intersegmental vessels, no expression in lymphatic vessels Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(-0.8flt1:RFP) ZDB-TGCONSTRCT-110504-1 2019-09-17
ZDB-ALT-060825-36 hu540a Point Mutation adult males treated with ENU Amino acid 285 of the zebrafish protein corresponds to amino acid 293 of the human ortholog. Hubrecht Institute ZDB-LAB-141201-1 Chr: 1 2019-09-17
ZDB-ALT-150818-1 hu5626 Point Mutation adult males treated with ENU Hermkens et al (2015): a guanine-to-adenine mutation leading to a predicted premature stop-codon (after amino acid 53) within the HMG domain of Sox7 Schulte-Merker ZDB-LAB-050429-4 Chr: 20 2019-09-17
ZDB-ALT-160729-4 hu5670 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 24 2019-09-17
ZDB-ALT-150810-2 hu5753 Unknown Bakkers Lab ZDB-LAB-031010-1 Chr: 23 2019-09-17
ZDB-ALT-140801-1 hu5855 lyc1, lymphatic and cardiac defects 1 Point Mutation mutation in pkd1a introducing a premature stop codon (R3607X). This mutation was predicted to result in the failed translation of six of the 11 transmembrane domains and essential C-terminal cytoplasmic tail of the protein Schulte-Merker ZDB-LAB-050429-4 Chr: 1 2019-09-17
ZDB-ALT-120404-1 hu5909Tg TgBAC_CU855796(sox9b:Citrine)hu5909, TgBAC(sox9b:Citrine)hu5909, TgFOS(sox9b:Citrine)hu5909 Transgenic Insertion embryos treated with DNA This transgenic line was not maintained. Schulte-Merker ZDB-LAB-050429-4 Unmapped TgFOS(sox9b:Citrine) ZDB-TGCONSTRCT-120404-1 2019-09-17
ZDB-ALT-120726-4 hu5910Tg TgBAC(col2a1a:mCherry)hu5910, tg(col2a1BAC:mCherry)hu5900 Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(col2a1a:mCherry) ZDB-TGCONSTRCT-120726-3 2019-09-17
ZDB-ALT-140805-2 hu5920 Point Mutation adult males treated with ENU Bonetti et al (2014)\nnonsense mutation in exon 3 of ptpn11b introducing a premature stop well upstream of the phosphatase catalytic site and hence, no functional protein is produced. den Hertog Lab ZDB-LAB-040713-1 Chr: 23 2019-09-17
ZDB-ALT-110802-4 hu5935 wickham, wkm Point Mutation adult males treated with ENU Bakkers Lab ZDB-LAB-031010-1 Chr: 5 2019-09-17
ZDB-ALT-130412-1 hu5939Tg TgBAC(entpd5a:YFP)hu5939 Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(entpd5a:YFP) ZDB-TGCONSTRCT-130412-1 2019-09-17
ZDB-ALT-110425-1 hu5985 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 3 2019-09-17
ZDB-ALT-140114-1 hu6023 Point Mutation Weijts et al (2012): A207-stop; mutation within the highly conserved first DNA-binding domain. Cuppen Lab ZDB-LAB-070815-1 Chr: 4 2019-09-17
ZDB-ALT-140114-2 hu6024 Point Mutation Weijts et al (2012): A2196-stop; mutation within the highly conserved first DNA-binding domain. Cuppen Lab ZDB-LAB-070815-1 Chr: 7 2019-09-17
ZDB-ALT-150616-1 hu6044 Point Mutation ENU This allle has a T to G substitution, creating a premature stop codon that leds to the interruption of of translation after 15 amino acids. Hubrecht Institute ZDB-LAB-141201-1 Chr: 16 2019-09-17
ZDB-ALT-170620-12 hu6123 Ly04-093 Point Mutation adult males treated with ENU Schulte-Merker ZDB-LAB-050429-4 Chr: 7 2019-09-17
ZDB-ALT-141009-2 hu6124 Point Mutation T->A mutation causes C339S in vecfc. Schulte-Merker ZDB-LAB-050429-4 Chr: 1 2019-09-17
ZDB-ALT-150128-4 hu6242Tg Transgenic Insertion embryos treated with DNA Ketting Lab ZDB-LAB-090422-1 Unmapped Tg(4xUAS:MYR-Tomato-h2az2a-23xG-EGFP) ZDB-TGCONSTRCT-150128-2 2019-09-17
ZDB-ALT-150128-3 hu6243Tg Transgenic Insertion embryos treated with DNA Ketting Lab ZDB-LAB-090422-1 Unmapped Tg(4xUAS:h2az2a-23xG-EGFP) ZDB-TGCONSTRCT-150128-1 2019-09-17
ZDB-ALT-130809-2 hu6410 Point Mutation The vegfchu6410 allele encodes a stop codon at amino acid position 107. Plasterk Lab ZDB-LAB-010309-1 Chr: 1 2019-09-17
ZDB-ALT-130502-1 hu6448 Point Mutation adult males treated with ENU carries a cysteine to threonine mutation in exon 4 of syne3 (ENSDARG00000023237) leading to the introduction of a premature stop codon at position 195 Cuppen Lab ZDB-LAB-070815-1 Chr: 17 2019-09-17
ZDB-ALT-151008-1 hu6531Tg Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped Tg(myl7:GAL4FF) ZDB-TGCONSTRCT-151008-1 2019-09-17
ZDB-ALT-121204-4 hu6635Tg TgBAC(isl1:Gal4ff)hu6635 Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped TgBAC(isl1:GAL4FF) ZDB-TGCONSTRCT-121204-1 2019-09-17
ZDB-ALT-151008-2 hu6851Tg Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped Tg(UAS:h2az2a-GFP) ZDB-TGCONSTRCT-151008-2 2019-09-17
ZDB-ALT-150223-1 hu6867Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(entpd5a:Kaede) ZDB-TGCONSTRCT-150223-1 2019-09-17
ZDB-ALT-170620-13 hu6985 Ly05-265 Point Mutation adult males treated with ENU Schulte-Merker ZDB-LAB-050429-4 Chr: 7 2019-09-17
ZDB-ALT-120229-1 hu7009Tg TgBAC(prox1b:Citrine)hu7009 Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(prox3:Citrine) ZDB-TGCONSTRCT-120229-1 2019-09-17
ZDB-ALT-130306-2 hu7050Tg TgBAC(col10a1:Citrine)hu7050 Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(col10a1a:Citrine) ZDB-TGCONSTRCT-130306-2 2019-09-17
ZDB-ALT-140521-1 hu7135Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(flt4:Citrine) ZDB-TGCONSTRCT-140521-1 2019-09-17
ZDB-ALT-030922-6 hu715 hu0715 Point Mutation adult males treated with ENU Plasterk Lab ZDB-LAB-010309-1 Chr: 17 2019-09-17
ZDB-ALT-150128-5 hu7161Tg Transgenic Insertion embryos treated with DNA Ketting Lab ZDB-LAB-090422-1 Unmapped Tg(hsp70l:mCherry-23xG-GAL4-VP16) ZDB-TGCONSTRCT-150128-3 2019-09-17
ZDB-ALT-190123-671 hu7275Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(kdrl:GAL4FF) ZDB-TGCONSTRCT-190123-2 2019-09-17
ZDB-ALT-180919-1 hu7426Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(cyp26b1:YFP) ZDB-TGCONSTRCT-180919-1 2019-09-17
ZDB-ALT-130214-1 hu7432Tg TgBAC(enpp1:enpp1,CMV:YFP)hu7432 Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(enpp1:enpp1,CMV:YFP) ZDB-TGCONSTRCT-130214-1 2019-09-17
ZDB-ALT-050914-2 hu745 mcr Point Mutation ENU Clevers Lab ZDB-LAB-031201-2 Chr: 10 2019-09-17
ZDB-ALT-181127-2 hu7478Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(entpd5a:KillerRed) ZDB-TGCONSTRCT-181127-1 2019-09-17
ZDB-ALT-120727-238 hu7857 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 10 2019-09-17
ZDB-ALT-120727-288 hu7858 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 10 2019-09-17
ZDB-ALT-120727-289 hu7861 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 11 2019-09-17
ZDB-ALT-120727-239 hu7862 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 12 2019-09-17
ZDB-ALT-120727-290 hu7869 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 16 2019-09-17
ZDB-ALT-120727-291 hu7873 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 19 2019-09-17
ZDB-ALT-120727-240 hu7875 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 2 2019-09-17
ZDB-ALT-120727-241 hu7878 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 20 2019-09-17
ZDB-ALT-120727-242 hu7879 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 21 2019-09-17
ZDB-ALT-120727-292 hu7881 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 21 2019-09-17
ZDB-ALT-120727-243 hu7885 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 22 2019-09-17
ZDB-ALT-120727-244 hu7894 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 3 2019-09-17
ZDB-ALT-120727-245 hu7895 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 3 2019-09-17
ZDB-ALT-120727-246 hu7897 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 4 2019-09-17
ZDB-ALT-120727-247 hu7900 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 5 2019-09-17
ZDB-ALT-120727-248 hu7901 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 5 2019-09-17
ZDB-ALT-120727-249 hu7903 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 5 2019-09-17
ZDB-ALT-120727-293 hu7905 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 13 2019-09-17
ZDB-ALT-120727-294 hu7910 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 7 2019-09-17
ZDB-ALT-120727-250 hu7911 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 8 2019-09-17
ZDB-ALT-120727-295 hu7912 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 8 2019-09-17
ZDB-ALT-120727-251 hu7915 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Chr: 9 2019-09-17
ZDB-ALT-120727-252 hu7916 Point Mutation adult males treated with ENU Cuppen Lab ZDB-LAB-070815-1 Ambiguous 2019-09-17
ZDB-ALT-080130-1 hu801 loc, lost-contact Point Mutation Bakkers Lab ZDB-LAB-031010-1 Chr: 10 2019-09-17
ZDB-ALT-120718-3 hu8653 cof Point Mutation adult males treated with ENU Mutation is a T839A transversion resulting in a lysine substitution for methionine at position 280. Bakkers Lab ZDB-LAB-031010-1 Chr: 25 2019-09-17
ZDB-ALT-131220-3 hu8654 rof Point Mutation adult males treated with ENU G->T mutation in exon 13 of fermt1 Bakkers Lab ZDB-LAB-031010-1 Chr: 20 2019-09-17
ZDB-ALT-140912-3 hu8811Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(5xUAS:enpp1-TagRFP,myl7:mTurquoise) ZDB-TGCONSTRCT-140912-3 2019-09-17
ZDB-ALT-100504-7 hu888 Point Mutation adult males treated with ENU Piasecka et al (2015): mutation at position 25762707 of the chromosome5 (GenBank accession no: NC_007116). This mutation is G to T point mutation at the splice acceptor site in the intron 8 of p53 gene.
A cryptic splice-acceptor site within exon 9 was used, resulting in the deletion of 12 nucleotides from the 5′ end of exon 9 in the p53mRNA. This leads to four amino acid removal in the encoded protein, from leucine-278 to glutamic acid-281 and with replacement serine by lysine at 277 position without changing the reading frame. Cuppen Lab ZDB-LAB-070815-1 Chr: 5 2019-09-17
ZDB-ALT-170620-14 hu8885Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped TgBAC(svep1:GAL4FF) ZDB-TGCONSTRCT-170620-1 2019-09-17
ZDB-ALT-090611-9 hu892 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 18 2019-09-17
ZDB-ALT-090611-10 hu893 Point Mutation adult males treated with ENU Hubrecht Institute ZDB-LAB-141201-1 Chr: 18 2019-09-17
ZDB-ALT-030922-2 hu894 Point Mutation adult males treated with ENU Plasterk Lab ZDB-LAB-010309-1 Chr: 17 2019-09-17
ZDB-ALT-030922-4 hu896 Point Mutation adult males treated with ENU Plasterk Lab ZDB-LAB-010309-1 Chr: 17 2019-09-17
ZDB-ALT-140902-3 hu9228Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(shha:vegfc,mTurquoise) ZDB-TGCONSTRCT-140902-3 2019-09-17
ZDB-ALT-140521-2 hu9236Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(Ola.Flt4:GAL4FF) ZDB-TGCONSTRCT-140521-3 2019-09-17
ZDB-ALT-140902-2 hu9282Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(shha:ccbe1,TagRFP) ZDB-TGCONSTRCT-140902-2 2019-09-17
ZDB-ALT-140912-1 hu9313Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(col2a1a:GAL4FF) ZDB-TGCONSTRCT-140912-1 2019-09-17
ZDB-ALT-140912-2 hu9381Tg Transgenic Insertion embryos treated with DNA Schulte-Merker ZDB-LAB-050429-4 Unmapped Tg(shha:GAL4FF) ZDB-TGCONSTRCT-140912-2 2019-09-17
ZDB-ALT-151008-3 hu9579Tg Transgenic Insertion embryos treated with DNA Bakkers Lab ZDB-LAB-031010-1 Unmapped TgBAC(nkx2.5:GAL4FF) ZDB-TGCONSTRCT-151008-3 2019-09-17
ZDB-ALT-160721-19 hu9963 Small Deletion embryos treated with TALEN1-nrp1a Frameshift at aa 96; 37 additional aa then stop. Schulte-Merker ZDB-LAB-050429-4 Chr: 24 2019-09-17
ZDB-ALT-160413-8 huj8Tg Transgenic Insertion embryos treated with DNA Inbal Lab ZDB-LAB-090526-1 Unmapped Tg(rx3:Kaede) ZDB-TGCONSTRCT-160413-4 2019-09-17
ZDB-ALT-150723-13 huj9Tg Transgenic Insertion embryos treated with DNA Inbal Lab ZDB-LAB-090526-1 Unmapped Tg(kdrl:Kaede) ZDB-TGCONSTRCT-150723-6 2019-09-17
ZDB-ALT-160113-1 hyo1Tg Transgenic Insertion embryos treated with DNA Hatta Lab ZDB-LAB-070419-3 Unmapped Tg(UAS:Cr.ChR2-EYFP) ZDB-TGCONSTRCT-160113-1 2019-09-17
ZDB-ALT-180410-1 hza1 Small Deletion embryos treated with CRISPR4-eaf1 deletion of CCGCC Jing-Xia Liu Lab ZDB-LAB-170209-9 Chr: 16 2019-09-17
ZDB-ALT-190408-2 hza2 Insertion embryos treated with CRISPR1-cox17 Jing-Xia Liu Lab ZDB-LAB-170209-9 Chr: 9 2019-09-17
ZDB-ALT-180517-3 hza51 Small Deletion embryos treated with CRISPR1-mir34a, si:ch211-28e16.5, CRISPR2-mir34a, si:ch211-28e16.5 This line was generated by injecting two CRISPRs which flank the mir34a gene. The authors demonstrated that the mir34a gene is deleted in this line. On the opposite strand from the mir34a gene is an EST si:ch211-28e16.5 which may also be affected by this deletion. Jie Mei Lab ZDB-LAB-170210-3 Unmapped 2019-09-17
ZDB-ALT-151125-17 hzm10Tg Transgenic Insertion embryos treated with DNA Lopez-Schier Lab ZDB-LAB-061020-1 Unmapped Tg(cldnb:ERT2-GAL4) ZDB-TGCONSTRCT-151125-1 2019-09-17
ZDB-ALT-151125-18 hzm11Tg Transgenic Insertion embryos treated with DNA Lopez-Schier Lab ZDB-LAB-061020-1 Unmapped Tg(UAS:Hsa.HIST1H2AL-mTurquoise) ZDB-TGCONSTRCT-151125-2 2019-09-17
ZDB-ALT-190819-2 hzm12Et This feature is representative of one or more unknown insertion sites. Tg(vdrb:mCherry) Transgenic Insertion embryos treated with DNA The insertion site was located in Zv9 build chromosome 6:38936157, in the first intron of the vdrb gene (ENSEMBL Gene ID ENSDARG00000070721). Köster Lab ZDB-LAB-060314-2 Unmapped Et(shhb:KALTA4,UAS-E1B:mCherry) ZDB-ETCONSTRCT-120217-3 2019-09-17
ZDB-ALT-090702-3 hzm1Et Et(kita:Gal4TA4,UAS:mCherry)hzm1 Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Et(kita:GAL4TA4,UAS:mCherry) ZDB-ETCONSTRCT-130122-1 2019-09-17
ZDB-ALT-100624-1 hzm2Tg Tg(atoh1a:Gal4TA4)hzm2 Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(atoh1a:GAL4TA4) ZDB-TGCONSTRCT-100624-1 2019-09-17
ZDB-ALT-100809-1 hzm3Tg Tg(4xUAS:GFP)hzm3 Transgenic Insertion DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(4xUAS:GFP) ZDB-TGCONSTRCT-100809-1 2019-09-17
ZDB-ALT-100809-2 hzm4Tg Tg(shhb:Gal4TA4, 5xUAS:mRFP)hzm4, Tg(shhb:GAL4TA4, 5xUAS:mRFP)hzm4, Tg(shhb:Gal4TA4, UAS:mRFP)hzm4, Tg(twhh:Gal4TA4, UAS:mRFP)hzm4 Transgenic Insertion DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(shhb:GAL4TA4,5xUAS:mRFP) ZDB-TGCONSTRCT-100809-2 2019-09-17
ZDB-ALT-110214-1 hzm5Et Et(zic4:Gal4TA4, UAS:mCherry)hzm5, Et(zic4:GAL4TA4, UAS:mCherry)hzm5 Transgenic Insertion embryos treated with DNA This line carries the Gal4 activator under control of a position effect of the enhancer of the zic1/zic4 gene.
Köster Lab ZDB-LAB-060314-2 Unmapped Et(zic4:GAL4TA4,UAS:mCherry) ZDB-ETCONSTRCT-110214-1 2019-09-17
ZDB-ALT-110413-1 hzm6Et Et(shhb:Gal4TA4,UAS:mCherry)hzm6 Transgenic Insertion embryos treated with DNA This enhancer trap line traps an egr2b enhancer. Köster Lab ZDB-LAB-060314-2 Unmapped Et(shhb:GAL4TA4,UAS:mCherry) ZDB-ETCONSTRCT-110413-2 2019-09-17
ZDB-ALT-141119-1 hzm7Et This feature is representative of one or more unknown insertion sites. hzm7Tg Transgenic Insertion embryos treated with DNA This insertion has been mapped and is close to phldb1b. Köster Lab ZDB-LAB-060314-2 Unmapped Et(shhb:KALTA4,UAS-E1B:mCherry) ZDB-ETCONSTRCT-120217-3 2019-09-17
ZDB-ALT-150528-2 hzm8Et Transgenic Insertion embryos treated with DNA The insertion location the Et(shhb:KALTA4,UAS-E1b:mCherry) transgene in this fish was determined to be approximately 22kb upstream of ENSDARG00000058274 in Zv8. Köster Lab ZDB-LAB-060314-2 Unmapped Et(shhb:KALTA4,UAS-E1B:mCherry) ZDB-ETCONSTRCT-120217-3 2019-09-17
ZDB-ALT-150529-3 hzm9Tg Transgenic Insertion embryos treated with DNA Köster Lab ZDB-LAB-060314-2 Unmapped Tg(her3:KALTA4) ZDB-TGCONSTRCT-150529-7 2019-09-17
ZDB-ALT-151027-1 hzu1 Small Deletion embryos treated with TALEN1-rp2 Liu et al (2015): c.359_363delCGGTC (5bp deletion). TALEN target Exon 2 Mugen Liu Lab ZDB-LAB-151014-1 Chr: 6 2019-09-17
ZDB-ALT-170612-1 hzu2 del12 Small Deletion embryos treated with TALEN1-rp2 Mugen Liu Lab ZDB-LAB-151014-1 Chr: 6 2019-09-17
ZDB-ALT-170816-1 hzu3 c.43_49delTGGTCGG, MT3 Small Deletion embryos treated with TALEN1-cerkl The 7 bp deletion caused a frame shift, resulting in an abnormal Trp15Argfs*21 protein. Mugen Liu Lab ZDB-LAB-151014-1 Chr: 9 2019-09-17
ZDB-ALT-180308-1 hzu4 Small Deletion embryos treated with TALEN1-eys Mugen Liu Lab ZDB-LAB-151014-1 Chr: 13 2019-09-17
ZDB-ALT-180320-6 hzu5 del7 Small Deletion embryos treated with TALEN1-hsf4 c.211_217del, p.Lys24- Glyfs10 Mugen Liu Lab ZDB-LAB-151014-1 Chr: 18 2019-09-17
ZDB-ALT-181217-10 hzu6 Small Deletion embryos treated with TALEN1-ush2a Between 136 bp to 162 bp of the wild-type ush2a coding sequence, GCCCCTCAGGGCAACTT, is deleted. Mugen Liu Lab ZDB-LAB-151014-1 Chr: 17 2019-09-17
ZDB-ALT-080923-1 i101Tg Tg(smyhc1:EGFP)i101 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(smyhc1:EGFP) ZDB-TGCONSTRCT-080923-1 2019-09-17
ZDB-ALT-080923-2 i102Tg Tg(smyhc1:EGFP)i102 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(smyhc1:EGFP) ZDB-TGCONSTRCT-080923-1 2019-09-17
ZDB-ALT-080923-3 i103Tg Tg(smyhc1:EGFP)i103 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(smyhc1:EGFP) ZDB-TGCONSTRCT-080923-1 2019-09-17
ZDB-ALT-080923-4 i104Tg Tg(smyhc1:EGFP)i104 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(smyhc1:EGFP) ZDB-TGCONSTRCT-080923-1 2019-09-17
ZDB-ALT-080923-5 i105Tg Tg(smyhc1:EGFP)i105 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(smyhc1:EGFP) ZDB-TGCONSTRCT-080923-1 2019-09-17
ZDB-ALT-080923-6 i106Tg TgPAC_F2219(prdm1a:EGFP)i106, TgPAC(prdm1a:EGFP)i106 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped TgPAC(prdm1a:EGFP) ZDB-TGCONSTRCT-080923-2 2019-09-17
ZDB-ALT-080923-7 i107Tg TgPAC_F2219(prdm1a:EGFP)i107, TgPAC(prdm1a:EGFP)i107 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped TgPAC(prdm1a:EGFP) ZDB-TGCONSTRCT-080923-2 2019-09-17
ZDB-ALT-080918-3 i108Tg TgBAC(smyhc1:EGFP)i108, TgBAC_ZC227E6(smyhc1:EGFP)i108 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped TgBAC(smyhc1:EGFP) ZDB-TGCONSTRCT-080918-1 2019-09-17
ZDB-ALT-080923-8 i111Tg Tg(-60prdm1a:EGFP)i111 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(-60prdm1a:EGFP) ZDB-TGCONSTRCT-080923-3 2019-09-17
ZDB-ALT-070118-1 i113Tg Tg(BACmpo:gfp)i113 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(mpx:GFP) ZDB-TGCONSTRCT-070118-1 2019-09-17
ZDB-ALT-070118-2 i114Tg Tg(BACmpo:gfp)i114, zf2111Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(mpx:GFP) ZDB-TGCONSTRCT-070118-1 2019-09-17
ZDB-ALT-111118-35 i124Tg TgBAC(myod1:EGFP)i124 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped TgBAC(myod1:EGFP) ZDB-TGCONSTRCT-111118-4 2019-09-17
ZDB-ALT-081230-1 i130Tg Tg((5M)mylz2:GFP)i130 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg2(mylpfa:GFP) ZDB-TGCONSTRCT-081230-1 2019-09-17
ZDB-ALT-111118-32 i131Tg TgBAC(pax7a:EGFP)i131 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped TgBAC(pax7a:EGFP) ZDB-TGCONSTRCT-111118-1 2019-09-17
ZDB-ALT-081112-1 i135Tg Tg(-2.2mylz2:GFP)i135 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(-2.2 mylpfa:GFP) ZDB-TGCONSTRCT-081112-1 2019-09-17
ZDB-ALT-110707-1 i149Tg Tg(UAS-E1b:NfsB-mCherry)i149 Transgenic Insertion embryos treated with DNA Lab D38 ZDB-LAB-050202-1 Unmapped Tg(UAS-E1B:NTR-mCherry) ZDB-TGCONSTRCT-070314-2 2019-09-17
ZDB-ALT-111118-34 i150Tg TgBAC(pax3a:EGFP)i150 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped TgBAC(pax3a:EGFP) ZDB-TGCONSTRCT-111118-3 2019-09-17
ZDB-ALT-111118-33 i167Tg TgBAC(pax7a:LY-Tomato)i167 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped TgBAC(pax7a:LY-Tomato) ZDB-TGCONSTRCT-111118-2 2019-09-17
ZDB-ALT-110707-2 i186Tg TgBAC(csf1ra:Gal4-VP16)i186 Transgenic Insertion embryos treated with DNA Lab D38 ZDB-LAB-050202-1 Unmapped TgBAC(csf1ra:GAL4-VP16) ZDB-TGCONSTRCT-110707-1 2019-09-17
ZDB-ALT-150429-1 i187Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg2(smyhc1:EGFP) ZDB-TGCONSTRCT-150429-1 2019-09-17
ZDB-ALT-050224-2 i2 Unknown Blagden, et al. (1997) tentatively concluded that i2 was allelic with bozm168 based on complementation analysis. Ingham Sheffield Lab ZDB-LAB-970730-83 Chr: 15 2019-09-17
ZDB-ALT-121031-2 i218Tg Tg(UAS:hif1ab,EGFP)i218 Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(UAS:hif1ab,EGFP) ZDB-TGCONSTRCT-121031-2 2019-09-17
ZDB-ALT-170627-1 i230 Point Mutation adult males treated with ENU G to A mutation in codon 698. Two splice forms are detected in the mutant, one with an inclusion of 118 bp from the intron, and the other with a 33 bp deletion from the exon. The former would result in a frameshift, and the latter in a truncated protein. Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped 2019-09-17
ZDB-ALT-110708-1 i232 Point Mutation adult males treated with ENU i232 is a point mutation (thymine to adenine) in the second exon of evx1, which changes a tyrosine codon into an ochre stop codon. If translated, the truncated protein product is expected to be non-functional. Homozygous viable and fertile. (Schulte et al. ZDB-PUB-110518-28 ) Ingham Sheffield Lab ZDB-LAB-970730-83 Ambiguous 2019-09-17
ZDB-ALT-110223-3 i233Tg Tg(-10eng2a:EGFP)i233 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(-10en2a:EGFP) ZDB-TGCONSTRCT-110223-3 2019-09-17
ZDB-ALT-110223-4 i234Tg Tg(-8eng2a:EGFP)i234 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(-8en2a:EGFP) ZDB-TGCONSTRCT-110223-4 2019-09-17
ZDB-ALT-110223-5 i235Tg Tg(eng2a.1:EGFP)i235 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg1(en2a:EGFP) ZDB-TGCONSTRCT-110223-5 2019-09-17
ZDB-ALT-110223-6 i236Tg Tg(eng2a.1:EGFP)i236 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg1(en2a:EGFP) ZDB-TGCONSTRCT-110223-5 2019-09-17
ZDB-ALT-110223-7 i237Tg Tg(eng2a.2:EGFP)i237 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg2(en2a:EGFP) ZDB-TGCONSTRCT-110223-6 2019-09-17
ZDB-ALT-110223-8 i238Tg Tg(eng2a.3:EGFP)i238 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg3(en2a:EGFP) ZDB-TGCONSTRCT-110223-7 2019-09-17
ZDB-ALT-110223-9 i239Tg Tg(eng2a.4:EGFP)i239 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg4(en2a:EGFP) ZDB-TGCONSTRCT-110223-8 2019-09-17
ZDB-ALT-110223-10 i240Tg Tg(eng2a.5:EGFP)i240 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg5(en2a:EGFP) ZDB-TGCONSTRCT-110223-9 2019-09-17
ZDB-ALT-110223-11 i241Tg Tg(eng2a.6:EGFP)i241 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg6(en2a:EGFP) ZDB-TGCONSTRCT-110223-10 2019-09-17
ZDB-ALT-110223-12 i242Tg Tg(eng2a.7:EGFP)i242 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg7(en2a:EGFP) ZDB-TGCONSTRCT-110223-11 2019-09-17
ZDB-ALT-110223-13 i243Tg Tg(eng2a.8:EGFP)i243 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg8(en2a:EGFP) ZDB-TGCONSTRCT-110223-12 2019-09-17
ZDB-ALT-110223-14 i244Tg Tg(eng2a.9:EGFP)i244 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg9(en2a:EGFP) ZDB-TGCONSTRCT-110223-13 2019-09-17
ZDB-ALT-110223-15 i245Tg Tg(eng2a.10:EGFP)i245 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg10(en2a:EGFP) ZDB-TGCONSTRCT-110223-14 2019-09-17
ZDB-ALT-110223-16 i246Tg Tg(eng2a.11:EGFP)i246 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg11(en2a:EGFP) ZDB-TGCONSTRCT-110223-15 2019-09-17
ZDB-ALT-110223-17 i247Tg Tg(eng2a.12:EGFP)i247 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg12(en2a:EGFP) ZDB-TGCONSTRCT-110223-16 2019-09-17
ZDB-ALT-110223-18 i248Tg Tg(eng2a.13:EGFP)i248 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg13(en2a:EGFP) ZDB-TGCONSTRCT-110223-17 2019-09-17
ZDB-ALT-110223-19 i249Tg Tg(eng2a.14:EGFP)i249 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg14(en2a:EGFP) ZDB-TGCONSTRCT-110223-18 2019-09-17
ZDB-ALT-110223-20 i250Tg Tg(eng2a.15:EGFP)i250 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg15(en2a:EGFP) ZDB-TGCONSTRCT-110223-19 2019-09-17
ZDB-ALT-110223-21 i251Tg Tg(eng2a.16:EGFP)i251 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg16(en2a:EGFP) ZDB-TGCONSTRCT-110223-20 2019-09-17
ZDB-ALT-111206-3 i252aTg i252, Tg(-7.6sox6:EGFP)i252, Tg(-7.6sox6:EGFP)i252a Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(-7.6sox6:EGFP) ZDB-TGCONSTRCT-111206-2 2019-09-17
ZDB-ALT-121031-1 i252bTg Tg(lyz:Gal4-VP16)i252b Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(lyz:GAL4-VP16) ZDB-TGCONSTRCT-121031-1 2019-09-17
ZDB-ALT-111206-4 i253Tg Tg(-2.8sox6:EGFP)i253 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(-2.8sox6:EGFP) ZDB-TGCONSTRCT-111206-3 2019-09-17
ZDB-ALT-111206-6 i254Tg Tg(-2sox6:EGFP)i254 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(-2sox6:EGFP) ZDB-TGCONSTRCT-111206-5 2019-09-17
ZDB-ALT-111206-5 i255Tg Tg(-1.5sox6:EGFP)i255 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(-1.5sox6:EGFP) ZDB-TGCONSTRCT-111206-4 2019-09-17
ZDB-ALT-111206-7 i256Tg Tg(-2.8sox6:mCherry)i256 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(-2.8sox6:mCherry) ZDB-TGCONSTRCT-111206-6 2019-09-17
ZDB-ALT-111206-8 i257Tg Tg(sox6:mCherry)i257 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(sox6:mCherry) ZDB-TGCONSTRCT-111206-7 2019-09-17
ZDB-ALT-111206-9 i258Tg Tg(-2.8sox6:EGFP-sox6.1)i258 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg1(-2.8sox6:EGFP-UTR-sox6) ZDB-TGCONSTRCT-111206-8 2019-09-17
ZDB-ALT-111207-8 i259Tg Tg(-2.8sox6:EGFP-sox6.2)i259 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg2(-2.8sox6:EGFP-UTR-sox6) ZDB-TGCONSTRCT-111207-4 2019-09-17
ZDB-ALT-000412-8 i26 Point Mutation ENU Ingham Sheffield Lab ZDB-LAB-970730-83 Chr: 7 2019-09-17
ZDB-ALT-111207-9 i260Tg Tg(-2.8sox6:EGFP-sox6.3)i260 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg3(-2.8sox6:EGFP-UTR-sox6) ZDB-TGCONSTRCT-111207-5 2019-09-17
ZDB-ALT-111206-2 i261Tg Tg(smyhc1:LY-Tomato)i261 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(smyhc1:LY-Tomato) ZDB-TGCONSTRCT-111206-1 2019-09-17
ZDB-ALT-120120-1 i262 Small Deletion embryos treated with zinc finger nuclease 18 to 5 bp replacement resulting in frameshift and a premature termination codon, predicted to yield protein truncated N-terminal to the fourth coiled-coil domain. Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 17 2019-09-17
ZDB-ALT-120120-2 i263 Insertion embryos treated with zinc finger nuclease CCAT insertion resulting in frameshift and a premature termination codon, predicted to yield protein truncated N-terminal to the fourth coiled-coil domain. Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 17 2019-09-17
ZDB-ALT-120120-3 i264 Insertion embryos treated with zinc finger nuclease 17-bp insertion resulting in frameshift and a premature termination codon, predicted to yield protein truncated N-terminal to the fourth coiled-coil domain. Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 17 2019-09-17
ZDB-ALT-120120-4 i265 Insertion embryos treated with zinc finger nuclease Single nt insertion (C) resulting in frameshift and a premature termination codon, predicted to yield protein truncated N-terminal to the fourth coiled-coil domain. Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 17 2019-09-17
ZDB-ALT-120120-5 i266 Small Deletion embryos treated with zinc finger nuclease CCACG deletion resulting in frameshift and a premature termination codon, predicted to yield protein truncated N-terminal to the fourth coiled-coil domain. Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 17 2019-09-17
ZDB-ALT-120120-6 i267 Small Deletion embryos treated with zinc finger nuclease 81 nucleotide in-frame deletion, homozygotes almost fully adult viable Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 17 2019-09-17
ZDB-ALT-120120-7 i268 Small Deletion embryos treated with zinc finger nuclease Six nucleotide in-frame deletion Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 17 2019-09-17
ZDB-ALT-120327-3 i269Tg Tg(actc1b:Gal4)i269 Transgenic Insertion embryos treated with DNA Ingham Singapore Lab ZDB-LAB-061109-2 Unmapped Tg(actc1b:GAL4) ZDB-TGCONSTRCT-120327-1 2019-09-17
ZDB-ALT-140515-1 i270Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped TgBAC(ptch2:HA-EGFP) ZDB-TGCONSTRCT-140416-1 2019-09-17
ZDB-ALT-150414-5 i271 kif7delta8 Small Deletion embryos treated with zinc finger nuclease This allele has a 8-bp deletion (GGACCTGG). Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 7 2019-09-17
ZDB-ALT-150414-6 i272 kif7delta7 Small Deletion embryos treated with zinc finger nuclease This allele has a 7-bp deletion (TTGTGGA). Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 7 2019-09-17
ZDB-ALT-150414-7 i273 Small Deletion embryos treated with zinc finger nuclease A 3 bp deletion that removes one amino acid (D250). Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 7 2019-09-17
ZDB-ALT-140717-3 i275 Small Deletion embryos treated with zinc finger nuclease Wang 2013: 12-bp deletion the deletion in gli2a gene results in the loss of four residues (QLLS283-286) in a region that is not highly conserved between Gli proteins. Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 9 2019-09-17
ZDB-ALT-140717-4 i276 Insertion embryos treated with zinc finger nuclease Wang 2013: 4-bp insertion in gli2a which causes a frame shift resulting in a premature stop codon at CDS-1167. The resultant truncated open reading frame is predicted to encode a 388 aa protein, the first 284 residues of which correspond to the N-terminus of Gli2a. This includes the Gli2a repressor domain but lacks the zinc finger DNA binding domain and nuclear localization domain. Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 9 2019-09-17
ZDB-ALT-140725-9 i277Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(lyz:akt2-EGFP) ZDB-TGCONSTRCT-140725-6 2019-09-17
ZDB-ALT-140522-1 i278 Indel embryos treated with zinc finger nuclease van Impel, et al. (2014): The prox1a^i278 allele harbors a 10 bp deletion in the first coding exon, resulting in a frame-shift after amino acid 149, and a premature stop codon after additional four amino acids. Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 17 2019-09-17
ZDB-ALT-150428-3 i280Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(smyhc1:GCaMP3) ZDB-TGCONSTRCT-150428-3 2019-09-17
ZDB-ALT-160707-12 i283 Small Deletion embryos treated with zinc finger nuclease the truncated region of Adrbk2 (Grk2) includes most of the regulator of G-protein signalling (RGS) domain, the entire kinase domain and the Pleckstrin homology (PH) domain Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 10 2019-09-17
ZDB-ALT-150730-1 i291 Unknown embryos treated with zinc finger nuclease Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 7 2019-09-17
ZDB-ALT-150730-2 i292 Unknown embryos treated with zinc finger nuclease Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 7 2019-09-17
ZDB-ALT-150428-2 i293Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped TgBAC(tnnc1b:EGFP-tnnc1b) ZDB-TGCONSTRCT-150428-2 2019-09-17
ZDB-ALT-150428-1 i295Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(UAS:sox6-EGFP) ZDB-TGCONSTRCT-150428-1 2019-09-17
ZDB-ALT-150730-3 i300 Unknown embryos treated with zinc finger nuclease Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 4 2019-09-17
ZDB-ALT-150730-4 i301 Unknown embryos treated with zinc finger nuclease Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 4 2019-09-17
ZDB-ALT-150723-1 i302Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(-2.5tnnc1b:EGFP-tnnc1b) ZDB-TGCONSTRCT-150723-1 2019-09-17
ZDB-ALT-150723-2 i303Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(-2.5tnnc1b:EGFP) ZDB-TGCONSTRCT-150723-2 2019-09-17
ZDB-ALT-150723-3 i304Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(-.270tnnc1b:EGFP-tnnc1b) ZDB-TGCONSTRCT-150723-3 2019-09-17
ZDB-ALT-150723-4 i305Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(tnnc1b:EGFP) ZDB-TGCONSTRCT-150723-4 2019-09-17
ZDB-ALT-150723-5 i306Tg Transgenic Insertion embryos treated with DNA Ingham Sheffield Lab ZDB-LAB-970730-83 Unmapped Tg(Hsa.TNNC1:EGFP) ZDB-TGCONSTRCT-150723-5 2019-09-17
ZDB-ALT-170628-2 i310 Small Deletion embryos treated with CRISPR2-myo18b Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 10 2019-09-17
ZDB-ALT-170628-3 i311 Small Deletion embryos treated with CRISPR2-myo18b Ingham Singapore Lab ZDB-LAB-061109-2 Chr: 10 2019-09-17
ZDB-ALT-040719-6 i33 bf33 Point Mutation ENU Ingham Sheffield Lab ZDB-LAB-970730-83 Chr: 6 2019-09-17
ZDB-ALT-120404-3 ia10Tg Tg(12xGli-Hsv.Tk:nlsmCherry)ia10 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(12xgli-HSV.Ul23:NLS-mCherry) ZDB-TGCONSTRCT-120403-2 2019-09-17
ZDB-ALT-120404-2 ia11Tg Tg(12xGli-Hsv.TK:GFP)ia11 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(12xgli-HSV.Ul23:GFP) ZDB-TGCONSTRCT-120403-1 2019-09-17
ZDB-ALT-130115-3 ia12Tg Tg(EPV.Tp1-Mmu.Hbb:EGFP)ia12 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(EPV.Tp1-Mmu.Hbb:EGFP) ZDB-TGCONSTRCT-090625-1 2019-09-17
ZDB-ALT-130212-11 ia15Tg Tg(12xSBE:nlsmCherry)ia15 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(12xSBE:NLS-mCherry) ZDB-TGCONSTRCT-130212-5 2019-09-17
ZDB-ALT-130212-12 ia16Tg Tg(12xSBE:EGFP)ia16 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(12xSBE:EGFP) ZDB-TGCONSTRCT-130212-4 2019-09-17
ZDB-ALT-130115-2 ia17Tg Tg(BMPRE:nlsmCherry)ia17 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(BMPRE:NLS-mCherry) ZDB-TGCONSTRCT-130115-2 2019-09-17
ZDB-ALT-130115-4 ia18Tg Tg(BMPRE:EGFP)ia18 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg2(BMPRE:EGFP) ZDB-TGCONSTRCT-130115-4 2019-09-17
ZDB-ALT-070215-2 ia1Tg Glu:GFP, Tg(gcga:GFP)ia1 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(gcga:GFP) ZDB-TGCONSTRCT-070215-2 2019-09-17
ZDB-ALT-170522-1 ia200 Small Deletion embryos treated with CRISPR1-ids The mutant fish harbors a 5 bp deletion (sequence CTACT) from nucleotide 241 to nucleotide 245 Moro Lab ZDB-LAB-131024-2 Chr: 14 2019-09-17
ZDB-ALT-130123-1 ia20Tg Tg(9xGCRE-HSV.Ul23:EGFP)ia20 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(9xGCRE-HSV.Ul23:EGFP) ZDB-TGCONSTRCT-130123-1 2019-09-17
ZDB-ALT-131030-1 ia21Tg Tg(4xHRE-TATA:EGFP)ia21 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(4xHRE-TATA:EGFP) ZDB-TGCONSTRCT-131030-1 2019-09-17
ZDB-ALT-150721-1 ia22Tg Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(4xHRE-TATA:mCherry,mylpfa:EGFP) ZDB-TGCONSTRCT-150721-1 2019-09-17
ZDB-ALT-190318-5 ia23 Small Deletion Argenton Lab ZDB-LAB-990226-9 Unmapped 2019-09-17
ZDB-ALT-190318-6 ia24Tg Transgenic Insertion Argenton Lab ZDB-LAB-990226-9 Unmapped 2019-09-17
ZDB-ALT-190318-7 ia25Tg Transgenic Insertion Argenton Lab ZDB-LAB-990226-9 Unmapped 2019-09-17
ZDB-ALT-070215-3 ia2Tg This feature is representative of one or more unknown insertion sites. nkx2.2a:GFP, Tg(-8.5nkx2.2a:GFP)ia2 Transgenic Insertion embryos treated with DNA Astone et al (2015) reported that the ia2 insertion, in Tg(-8.5nkx2.2a:GFP)^ia2 embryos, was associated with a deletion of 15.2 Mb in the telomeric portion of chromosome 1. The current ZFIN database structure is not designed to record this case of Transgenic Insertion associated with a Deficiency.
As a solution, the Transgenic Insertion and the Deficiency were recorded separately as ia2Tg (ZDB-ALT-070215-3) and ia2a (ZDB-ALT-180521-8), respectively, with an “is_allele” relationship to an imaginary gene “unm_ia2” (ZDB-GENE-180521-1). It must be noted the ia2 deletion (deficiency, ia2a) is apparently co-inherited with the ia2 transgene (ia2Tg).
For more details, please contact ZFIN. Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(-8.5nkx2.2a:GFP) ZDB-TGCONSTRCT-070215-3 2019-09-17
ZDB-ALT-170222-2 ia30 Insertion embryos treated with CRISPR1-nr3c1 Argenton Lab ZDB-LAB-990226-9 Chr: 14 2019-09-17
ZDB-ALT-190206-1 ia300Tg Transgenic Insertion embryos treated with DNA Tiso Lab ZDB-LAB-080627-1 Unmapped Tg(tg:EGFP,myl7:EGFP) ZDB-TGCONSTRCT-190206-1 2019-09-17
ZDB-ALT-180920-7 ia31 Small Deletion embryos treated with CRISPR Argenton Lab ZDB-LAB-990226-9 Chr: 5 2019-09-17
ZDB-ALT-071024-1 ia3Tg Tg(-3.5nkx2.2a:GFP)ia3 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(-3.5nkx2.2a:GFP) ZDB-TGCONSTRCT-071024-1 2019-09-17
ZDB-ALT-150721-2 ia48Tg Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(Hsa.CTGF:EGFP) ZDB-TGCONSTRCT-150721-2 2019-09-17
ZDB-ALT-150721-3 ia49Tg Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(Hsa.CTGF:NLS-mCherry) ZDB-TGCONSTRCT-150721-3 2019-09-17
ZDB-ALT-110113-1 ia4Tg Tg(7xTCF-Xla.Siam:GFP)ia4, Wnt:GFP Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(7xTCF-Xla.Sia:GFP) ZDB-TGCONSTRCT-110113-1 2019-09-17
ZDB-ALT-150626-1 ia50Tg Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(-2.5neurod1:EGFP) ZDB-TGCONSTRCT-150626-2 2019-09-17
ZDB-ALT-160621-11 ia51Tg Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(mnx1:MITO-Kaede) ZDB-TGCONSTRCT-160621-5 2019-09-17
ZDB-ALT-110113-2 ia5Tg Tg(7xTCF-Xla.Siam:nlsmCherry)ia5 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(7xTCF-Xla.Sia:NLS-mCherry) ZDB-TGCONSTRCT-110113-2 2019-09-17
ZDB-ALT-101201-1 ia6Tg Tg(-5.5ptf1a:DsRed)ia6 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(-5.5ptf1a:DsRed) ZDB-TGCONSTRCT-101201-1 2019-09-17
ZDB-ALT-130115-1 ia7Tg Tg(EPV.TP1-Mmu.Hbb:nlsmCherry)ia7 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(EPV.Tp1-Mmu.Hbb:NLS-mCherry) ZDB-TGCONSTRCT-130115-1 2019-09-17
ZDB-ALT-111115-1 ia8Tg Tg(-1.2ins:HSV.UL23-GFP)ia8 Transgenic Insertion embryos treated with DNA Argenton Lab ZDB-LAB-990226-9 Unmapped Tg(-1.2ins:HSV.Ul23-GFP) ZDB-TGCONSTRCT-111115-1 2019-09-17
ZDB-ALT-111115-13 ib1Tg line 1, Tg(Mmu.Prrx1:EGFP)ib1 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg(Mmu.Prrx1:EGFP) ZDB-TGCONSTRCT-111115-30 2019-09-17
ZDB-ALT-111115-14 ib2Tg line 2, Tg(Mmu.Prrx1:EGFP)ib2 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg(Mmu.Prrx1:EGFP) ZDB-TGCONSTRCT-111115-30 2019-09-17
ZDB-ALT-111115-15 ib3Tg line 5, Tg(Mmu.Prrx1:EGFP)ib3 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg(Mmu.Prrx1:EGFP) ZDB-TGCONSTRCT-111115-30 2019-09-17
ZDB-ALT-111115-16 ib4Tg a2, Tg(prrx1a:EGFP)ib4 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg(prrx1a:EGFP) ZDB-TGCONSTRCT-111115-31 2019-09-17
ZDB-ALT-111115-17 ib5Tg a6, Tg(prrx1a:EGFP)ib5 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg(prrx1a:EGFP) ZDB-TGCONSTRCT-111115-31 2019-09-17
ZDB-ALT-111115-18 ib6Tg b1.5, Tg(prrx1b.1:EGFP)ib6 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg1(prrx1b:EGFP) ZDB-TGCONSTRCT-111115-32 2019-09-17
ZDB-ALT-111115-19 ib7Tg b1.8, Tg(prrx1b.1:EGFP)ib7 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg1(prrx1b:EGFP) ZDB-TGCONSTRCT-111115-32 2019-09-17
ZDB-ALT-111115-20 ib8Tg b2.11, Tg(prrx1b.2:EGFP)ib8 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg2(prrx1b:EGFP) ZDB-TGCONSTRCT-111115-33 2019-09-17
ZDB-ALT-111115-21 ib9Tg b2.13, Tg(prrx1b.2:EGFP)ib9 Transgenic Insertion embryos treated with DNA Minguillon Lab ZDB-LAB-110915-1 Unmapped Tg2(prrx1b:EGFP) ZDB-TGCONSTRCT-111115-33 2019-09-17
ZDB-ALT-170207-1 ibl150Tg Transgenic Insertion embryos treated with DNA Meijer Lab ZDB-LAB-170207-1 Unmapped Tg(cxcl18b:EGFP) ZDB-TGCONSTRCT-170207-1 2019-09-17
ZDB-ALT-141020-1 ibl1Tg Transgenic Insertion embryos treated with DNA Spaink Lab ZDB-LAB-070104-2 Unmapped Tg(14xUAS:GFP-Hsa.EWSR1-Hsa.ERG) ZDB-TGCONSTRCT-141020-1 2019-09-17
ZDB-ALT-120611-3 ibl30 Insertion zinc finger nuclease rnf2 knockout was generated using zinc finger nuclease. This mutation causes the insertion of 4bp resulting in an open reading frame-shift that leads to a premature stop codon Haramis Lab ZDB-LAB-110408-2 Chr: 2 2019-09-17
ZDB-ALT-120611-1 ibl31 Small Deletion zinc finger nuclease rnf2 knockout was generated using zinc finger nuclease. This mutation causes the deletion of 14bp resulting in an open reading frame-shift that leads to a premature stop codon Haramis Lab ZDB-LAB-110408-2 Chr: 2 2019-09-17
ZDB-ALT-170920-6 ibl40Tg Transgenic Insertion embryos treated with DNA Schaaf Lab ZDB-LAB-170906-3 Unmapped Tg(14xUAS:d1EGFP-nr3c1) ZDB-TGCONSTRCT-170920-1 2019-09-17
ZDB-ALT-190830-7 ibl50 Small Deletion the mutation has created a 46 bp deletion in the first exon, directly after the first transmembrane domain which guarantees that the GPCR is entirely dysfunctional Meijer Lab ZDB-LAB-170207-1 Unmapped 2019-09-17
ZDB-ALT-190218-1 ibl51 Small Deletion embryos treated with CRISPR1-optn short guide RNA was designed to target the beginning of coding exon 2, upstream of the exons encoding the ubiquitin and Lc3 binding regions, such that the effect of CRISPR mutation is a complete loss of protein function Meijer Lab ZDB-LAB-170207-1 Chr: 4 2019-09-17
ZDB-ALT-190218-2 ibl52 Small Deletion embryos treated with CRISPR1-sqstm1 short guide RNA was designed to target the beginning of coding exon 2 of sqstm1/p62, upstream of the exons encoding the ubiquitin and Lc3 binding regions, such that the effect of CRISPR mutation is a complete loss of protein function Meijer Lab ZDB-LAB-170207-1 Chr: 14 2019-09-17
ZDB-ALT-190711-3 ibl53 Small Deletion embryos treated with CRISPR1-dram1 short guide RNA was designed to target the first coding exon, such that the effect of CRISPR mutation is a complete loss of protein function Meijer Lab ZDB-LAB-170207-1 Unmapped 2019-09-17
ZDB-ALT-110203-6 ibr1Tg Tg(zff9:EGFP)ibr1 Transgenic Insertion embryos treated with DNA Calcaterra Lab ZDB-LAB-100930-1 Unmapped Tg(cnbpa:EGFP) ZDB-TGCONSTRCT-110203-5 2019-09-17
ZDB-ALT-150727-2 ibr2Tg Transgenic Insertion embryos treated with DNA Calcaterra Lab ZDB-LAB-100930-1 Unmapped Tg(Xla.Eef1a1:cnbpa-EGFP) ZDB-TGCONSTRCT-150727-3 2019-09-17
ZDB-ALT-150727-3 ibr3Tg Transgenic Insertion embryos treated with DNA This line was generated by transgenic insertion of a short cDNA sequence coding for a CNBP form lacking the first CCHC and the RGG motifs in frame with the sequence conding for eGFP Calcaterra Lab ZDB-LAB-100930-1 Unmapped Tg(Xla.Eef1a1:cnbpa_M1-G35del-EGFP) ZDB-TGCONSTRCT-150727-2 2019-09-17
ZDB-ALT-150601-1 ic3020Tg p3020 Transgenic Insertion embryos treated with DNA and CRISPR Del Bene Lab ZDB-LAB-100607-1 Unmapped TgBAC(neurod1:KALTA4) ZDB-TGCONSTRCT-150601-2 2019-09-17
ZDB-ALT-150601-2 ic3021Tg Transgenic Insertion embryos treated with DNA Del Bene Lab ZDB-LAB-100607-1 Unmapped Tg(UAS:sypb-GFP) ZDB-TGCONSTRCT-150601-1 2019-09-17
ZDB-ALT-160817-2 ic3023 Small Deletion embryos treated with TALEN1-kif5aa homozygotes fail to inflate their swim bladders and die 10 days post-fertilization; frameshift at amino acid 122 and a premature stop codon after 162 of 1033 aa's within the motor domain of Kif5aa Del Bene Lab ZDB-LAB-100607-1 Chr: 9 2019-09-17
ZDB-ALT-160817-3 ic3024 Small Deletion embryos treated with TALEN1-kif5aa homozygotes fail to inflate their swim bladders and die 10 days post-fertilization; frameshift at amino acid 122 and a premature stop codon after 162 of 1033 aa's within the motor domain of Kif5aa Del Bene Lab ZDB-LAB-100607-1 Chr: 9 2019-09-17
ZDB-ALT-151204-1 ic3025Tg Transgenic Insertion embryos treated with DNA Del Bene Lab ZDB-LAB-100607-1 Unmapped Tg(isl2b:GAL4,myl7:EGFP) ZDB-TGCONSTRCT-151204-2 2019-09-17
ZDB-ALT-151204-9 ic3026Tg Transgenic Insertion embryos treated with DNA Del Bene Lab ZDB-LAB-100607-1 Unmapped Tg2(UAS:mCherry) ZDB-TGCONSTRCT-151204-10 2019-09-17
ZDB-ALT-160912-4 ic3027Tg Transgenic Insertion embryos treated with DNA Del Bene Lab ZDB-LAB-100607-1 Unmapped Tg(rpl5b:GAL4) ZDB-TGCONSTRCT-160909-1 2019-09-17
ZDB-ALT-160912-5 ic3028Tg Transgenic Insertion embryos treated with DNA Del Bene Lab ZDB-LAB-100607-1 Unmapped Tg(rx2:GAL4,myl7:EGFP) ZDB-TGCONSTRCT-160909-2 2019-09-17
ZDB-ALT-160912-6 ic3029Tg Transgenic Insertion embryos treated with DNA Del Bene Lab ZDB-LAB-100607-1 Unmapped Tg(UAS:zCas9-2A-EGFP,rnu6-4:sgRNA1,rnu6-4:sgRNA2) ZDB-TGCONSTRCT-160912-5 2019-09-17
ZDB-ALT-190130-2 ic3030 Insertion embryos treated with CRISPR1-vldlr Del Bene Lab ZDB-LAB-100607-1 Chr: 10 2019-09-17
ZDB-ALT-190408-1 ic3030aTg ic3030 Transgenic Insertion embryos treated with DNA Del Bene Lab ZDB-LAB-100607-1 Unmapped Tg(UAS:zCas9-2A-EGFP,rnu6-4:CRISPR1-tyr,rnu6-4:CRISPR3-tyr) ZDB-TGCONSTRCT-190405-1 2019-09-17
ZDB-ALT-190130-3 ic3031 Small Deletion embryos treated with CRISPR1-dab1a Del Bene Lab ZDB-LAB-100607-1 Chr: 20 2019-09-17
ZDB-ALT-190130-4 ic3032 Indel embryos treated with TALEN1-reln Del Bene Lab ZDB-LAB-100607-1 Chr: 18 2019-09-17
ZDB-ALT-190304-1 ic3033Tg Transgenic Insertion embryos treated with DNA Del Bene Lab ZDB-LAB-100607-1 Unmapped Tg(10xUAS:BLINK2,myl7:EGFP) ZDB-TGCONSTRCT-190304-1 2019-09-17
ZDB-ALT-160323-7 icl1 popdc1 191F Point Mutation embryos treated with TALEN1-bves Popdc1S191F is a knockin of a point mutation at position 191 of the Popdc1 (bves) protein. Thomas Brand Lab ZDB-LAB-120606-1 Chr: 16 2019-09-17
ZDB-ALT-160816-1 icl100Tg Transgenic Insertion embryos treated with DNA Dallman Lab ZDB-LAB-140127-1 Unmapped Tg(ubb:SECFP) ZDB-TGCONSTRCT-160816-1 2019-09-17
ZDB-ALT-160816-2 icl101Tg Transgenic Insertion embryos treated with DNA Dallman Lab ZDB-LAB-140127-1 Unmapped Tg(ubb:SECFP-DEVD-YFP) ZDB-TGCONSTRCT-160816-2 2019-09-17
ZDB-ALT-160119-6 icm02 Small Deletion embryos treated with TALEN1-pkd2l1 stop codon is upstream of the first transmembrane domain of Pkd2l1 Wyart Lab ZDB-LAB-110606-1 Chr: 13 2019-09-17
ZDB-ALT-160405-1 icm05Tg NeuroD:GCaMP6F Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(neurod1:GCaMP6F) ZDB-TGCONSTRCT-160405-1 2019-09-17
ZDB-ALT-160119-5 icm06Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(UAS:GCaMP,cryaa:mCherry) ZDB-TGCONSTRCT-160119-2 2019-09-17
ZDB-ALT-160119-4 icm07Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(pkd2l1:GCaMP5G) ZDB-TGCONSTRCT-160119-1 2019-09-17
ZDB-ALT-150417-4 icm08Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(UAS:GCaMP5G) ZDB-TGCONSTRCT-150417-4 2019-09-17
ZDB-ALT-170828-1 icm09Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(UAS:GFP-Aequorin) ZDB-TGCONSTRCT-170828-1 2019-09-17
ZDB-ALT-150324-1 icm10Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(pkd2l1:GAL4) ZDB-TGCONSTRCT-150324-1 2019-09-17
ZDB-ALT-150324-2 icm11Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(UAS:Cr.ChR2-YFP) ZDB-TGCONSTRCT-150324-2 2019-09-17
ZDB-ALT-160119-10 icm12Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(UAS:ChloC-EGFP,cryaa:mCherry) ZDB-TGCONSTRCT-160119-7 2019-09-17
ZDB-ALT-181113-3 icm13 Small Deletion embryos treated with CRISPR1-scospondin The icm13 allele of scospondin has a frameshift mutation giving rise to a truncated protein devoid of any of the scospondin domains, likely to be null. Wyart Lab ZDB-LAB-110606-1 Chr: 24 2019-09-17
ZDB-ALT-181113-4 icm15 Insertion embryos treated with CRISPR1-scospondin The icm15 allele of scospondin exhibits five extra amino acids in the single EMI domain, a protein-protein interaction domain found in the Emilin protein family. Wyart Lab ZDB-LAB-110606-1 Chr: 24 2019-09-17
ZDB-ALT-160119-8 icm17Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(pkd2l1:TagRFP) ZDB-TGCONSTRCT-160119-5 2019-09-17
ZDB-ALT-160119-9 icm21Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(UAS:BoTxBLC-GFP) ZDB-TGCONSTRCT-160119-6 2019-09-17
ZDB-ALT-160119-7 icm22Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(UAS:TagRFP-CAAX,myl7:EGFP) ZDB-TGCONSTRCT-160119-4 2019-09-17
ZDB-ALT-160120-1 icm23Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg1(mnx1:GAL4) ZDB-TGCONSTRCT-160119-3 2019-09-17
ZDB-ALT-160427-5 icm25Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(mnx1:GCaMP5G) ZDB-TGCONSTRCT-160427-5 2019-09-17
ZDB-ALT-170113-19 icm28Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(UAS:LIFEACT-GFP,cryaa:Venus) ZDB-TGCONSTRCT-170113-9 2019-09-17
ZDB-ALT-190513-1 icm33Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped Tg(myo6b:LIFEACT-TagRFP,cryaa:mCherry) ZDB-TGCONSTRCT-190513-1 2019-09-17
ZDB-ALT-190115-1 icm47Tg Transgenic Insertion embryos treated with DNA Wyart Lab ZDB-LAB-110606-1 Unmapped 2019-09-17
ZDB-ALT-180129-10 idc10Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(myo6b:GFP-p2A-rpl10a) ZDB-TGCONSTRCT-180129-4 2019-09-17
ZDB-ALT-190102-4 idc11Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped 2019-09-17
ZDB-ALT-190102-5 idc12Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped 2019-09-17
ZDB-ALT-190102-6 idc13Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped 2019-09-17
ZDB-ALT-190124-2 idc14 Small Deletion embryos treated with CRISPR1-cdc14aa p.G284fs4X, c.del 854_860; NM_201149 Kindt Lab ZDB-LAB-150304-1 Chr: 2 2019-09-17
ZDB-ALT-170113-3 idc1Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(myo6b:GCaMP6s-CAAX) ZDB-TGCONSTRCT-170113-6 2019-09-17
ZDB-ALT-170113-4 idc2Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(myo6b:ctbp2a-mCherry) ZDB-TGCONSTRCT-170113-4 2019-09-17
ZDB-ALT-170113-5 idc3Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(myo6b:ctbp2l-mCherry) ZDB-TGCONSTRCT-170113-5 2019-09-17
ZDB-ALT-170606-4 idc4Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(myo6b:emx2-2A-NLS-mCherry) ZDB-TGCONSTRCT-170606-3 2019-09-17
ZDB-ALT-170606-5 idc5 Small Deletion embryos treated with CRISPR2-emx2 Kindt Lab ZDB-LAB-150304-1 Chr: 13 2019-09-17
ZDB-ALT-171205-5 idc6Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(myo6b:SYPHY) ZDB-TGCONSTRCT-171205-4 2019-09-17
ZDB-ALT-171205-6 idc7Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(myo6b:jRCaMP-CAAX) ZDB-TGCONSTRCT-171205-5 2019-09-17
ZDB-ALT-171206-1 idc8Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(hsp70l:GCaMP6s-CAAX-SILL1) ZDB-TGCONSTRCT-171206-1 2019-09-17
ZDB-ALT-171205-7 idc9Tg Transgenic Insertion embryos treated with DNA Kindt Lab ZDB-LAB-150304-1 Unmapped Tg(myo6b:Bongwoori-2A-NLSmCherry) ZDB-TGCONSTRCT-171205-6 2019-09-17
ZDB-ALT-080108-1 ift88_unspecified un_ift88, unspecified_ift88 Unspecified Ambiguous 2019-09-17
ZDB-ALT-161017-10 ig11Tg Transgenic Insertion embryos treated with DNA Vermot Lab ZDB-LAB-150617-1 Unmapped Tg(klf2a:H2b-EGFP) ZDB-TGCONSTRCT-161017-12 2019-09-17
ZDB-ALT-150617-2 ig1Tg Transgenic Insertion embryos treated with DNA Vermot Lab ZDB-LAB-150617-1 Unmapped Tg(UAS:klf2a) ZDB-TGCONSTRCT-150617-2 2019-09-17
ZDB-ALT-150617-3 ig2Tg Transgenic Insertion embryos treated with DNA Vermot Lab ZDB-LAB-150617-1 Unmapped Tg(UAS:klf2a) ZDB-TGCONSTRCT-150617-2 2019-09-17
ZDB-ALT-150617-4 ig3Tg Transgenic Insertion embryos treated with DNA Vermot Lab ZDB-LAB-150617-1 Unmapped Tg(UAS:klf2a) ZDB-TGCONSTRCT-150617-2 2019-09-17
ZDB-ALT-161103-5 ig4 Indel embryos treated with TALEN1-klf2a Vermot Lab ZDB-LAB-150617-1 Chr: 22 2019-09-17
ZDB-ALT-111101-3 ihb100Tg Tg(Cca.Actb:Vst.Vhb,CMV:EGFP)ihb100 Transgenic Insertion embryos treated with DNA This line was not maintained. Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(Cca.Actb:Vst.Vhb,CMV:EGFP) ZDB-TGCONSTRCT-111101-6 2019-09-17
ZDB-ALT-111101-4 ihb101Tg Tg(Cca.Actb:Vst.Vhb,CMV:EGFP)ihb101 Transgenic Insertion embryos treated with DNA This line was not maintained. Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(Cca.Actb:Vst.Vhb,CMV:EGFP) ZDB-TGCONSTRCT-111101-6 2019-09-17
ZDB-ALT-111101-5 ihb102Tg Tg(Cca.Actb:Vst.Vhb,CMV:EGFP)ihb102 Transgenic Insertion embryos treated with DNA This line was not maintained. Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(Cca.Actb:Vst.Vhb,CMV:EGFP) ZDB-TGCONSTRCT-111101-6 2019-09-17
ZDB-ALT-111101-6 ihb103Tg Tg(Cca.Actb:Vst.Vhb,CMV:EGFP)ihb103 Transgenic Insertion embryos treated with DNA This line was not maintained. Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(Cca.Actb:Vst.Vhb,CMV:EGFP) ZDB-TGCONSTRCT-111101-6 2019-09-17
ZDB-ALT-111101-7 ihb104Tg Tg(Cca.Actb:Vst.Vhb,CMV:EGFP)ihb104 Transgenic Insertion embryos treated with DNA This line was not maintained. Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(Cca.Actb:Vst.Vhb,CMV:EGFP) ZDB-TGCONSTRCT-111101-6 2019-09-17
ZDB-ALT-111101-8 ihb105Tg Tg(Cca.Actb:Vst.Vhb,CMV:EGFP)ihb105 Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(Cca.Actb:Vst.Vhb,CMV:EGFP) ZDB-TGCONSTRCT-111101-6 2019-09-17
ZDB-ALT-111101-9 ihb106Tg Tg(Cca.Actb:Vst.Vhb,CMV:EGFP)ihb106 Transgenic Insertion embryos treated with DNA This line was not maintained. Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(Cca.Actb:Vst.Vhb,CMV:EGFP) ZDB-TGCONSTRCT-111101-6 2019-09-17
ZDB-ALT-111101-10 ihb107Tg Tg(Cca.Actb:Vst.Vhb,CMV:EGFP)ihb107 Transgenic Insertion embryos treated with DNA This line was not maintained. Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(Cca.Actb:Vst.Vhb,CMV:EGFP) ZDB-TGCONSTRCT-111101-6 2019-09-17
ZDB-ALT-150602-6 ihb108Tg TG1 Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(CMV:GAL4,CMV:EGFP) ZDB-TGCONSTRCT-150602-3 2019-09-17
ZDB-ALT-150602-7 ihb109Tg TG2 Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(5xUAS:dnd1,CMV:RFP) ZDB-TGCONSTRCT-150602-4 2019-09-17
ZDB-ALT-130207-1 ihb10Tg Tg(kop:LOXP-SV40-LOXP-mRFP-UTRnanos3,CMV:EGFP)ihb10 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(kop:LOXP-SV40-LOXP-mRFP-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-130207-1 2019-09-17
ZDB-ALT-150602-9 ihb110Tg TG4 Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(CMV:GAL4,CMV:EGFP) ZDB-TGCONSTRCT-150602-3 2019-09-17
ZDB-ALT-150602-8 ihb111Tg TG6 Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(5xUAS:EGFP,CMV:RFP) ZDB-TGCONSTRCT-150602-5 2019-09-17
ZDB-ALT-160429-1 ihb112 Indel embryos treated with CRISPR1-irf1b exon1 deletion, deletion of CAACAAGGT at 80bp, splice-site alteration Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-160429-2 ihb113Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:mCherry-Ocu.UTRHbb2) ZDB-TGCONSTRCT-160429-1 2019-09-17
ZDB-ALT-160429-3 ihb114Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(actb1:Spy.Cas9-UTRactb1) ZDB-TGCONSTRCT-160429-2 2019-09-17
ZDB-ALT-160429-4 ihb115Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:Spy.Cas9-UTRnanos3) ZDB-TGCONSTRCT-160429-3 2019-09-17
ZDB-ALT-150922-1 ihb116Tg Transgenic Insertion embryos treated with DNA Zhan Yin Lab ZDB-LAB-110330-2 Unmapped Tg(dnd1:NTR-EGFP) ZDB-TGCONSTRCT-150922-1 2019-09-17
ZDB-ALT-160429-5 ihb117 Indel embryos treated with CRISPR1-slc26a6 exon3, 1bp deletion, 2bp insertion, frameshift Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 8 2019-09-17
ZDB-ALT-160429-6 ihb118 Small Deletion embryos treated with CRISPR1-slc26a6 exon3, 10bp deletion, frameshift Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 8 2019-09-17
ZDB-ALT-160429-7 ihb119Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:d2EGFP-UTRnanos3), Tg(UAS:mRFP-UTRnanos3) ZDB-TGCONSTRCT-160429-5, ZDB-TGCONSTRCT-160429-4 2019-09-17
ZDB-ALT-130207-2 ihb11Tg Tg(UAS:casp3a-UTRnanos3,CMV:EGFP)ihb11 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:casp3a-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-130207-2 2019-09-17
ZDB-ALT-160429-8 ihb120Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:buc-UTRnanos3) ZDB-TGCONSTRCT-160429-6 2019-09-17
ZDB-ALT-160804-3 ihb121 Small Deletion embryos treated with CRISPR1-lrrn1 Between 577 bp to 580 bp of the wild-type lrrn1 coding sequence, AACC, is deleted. The mutated lrrn1 codes for a truncated protein containing 196 aa, 192 aa of which is identical to wildtype lrrn1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-160804-4 ihb122 Indel embryos treated with CRISPR1-lrrn1 571 bp to 577 bp of the wild-type lrrn1 coding sequence, ACCCCCA, is mutated into GG. The mutated lrrn1 codes for a truncated protein containing 206 aa, 190 aa of which is identical to wildtype lrrn1. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-161228-1 ihb1225 Small Deletion embryos treated with CRISPR1-ar 11 bp deleted in exon 4 Xiao Lab ZDB-LAB-101011-1 Chr: 5 2019-09-17
ZDB-ALT-170119-1 ihb1226 Small Deletion embryos treated with CRISPR1-ar 2 bp deletion in exon 4 Xiao Lab ZDB-LAB-101011-1 Chr: 5 2019-09-17
ZDB-ALT-180718-1 ihb1227 Small Deletion embryos treated with CRISPR1-nedd8 Xiao Lab ZDB-LAB-101011-1 Chr: 7 2019-09-17
ZDB-ALT-180803-3 ihb1228 Small Deletion embryos treated with CRISPR1-egln1a Xiao Lab ZDB-LAB-101011-1 Chr: 13 2019-09-17
ZDB-ALT-180803-4 ihb1229 Small Deletion embryos treated with CRISPR1-egln1b Xiao Lab ZDB-LAB-101011-1 Chr: 11 2019-09-17
ZDB-ALT-160804-5 ihb123 Small Deletion embryos treated with CRISPR1-kdrl Between 767 bp to 770 bp of the wild-type kdrl coding sequence, AGTG, is deleted. The mutated kdrl codes for a truncated protein containing 280 aa, 255 aa of which is identical to wildtype kdrl Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 14 2019-09-17
ZDB-ALT-180803-5 ihb1230 Small Deletion embryos treated with CRISPR1-egln3 Xiao Lab ZDB-LAB-101011-1 Chr: 17 2019-09-17
ZDB-ALT-160429-9 ihb124Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:bmp2b-UTRnanos3) ZDB-TGCONSTRCT-160429-7 2019-09-17
ZDB-ALT-160429-10 ihb125Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:Ssc.caGhr-UTRnanos3) ZDB-TGCONSTRCT-160429-8 2019-09-17
ZDB-ALT-160429-11 ihb126Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:dkk1b-UTRnanos3) ZDB-TGCONSTRCT-160429-9 2019-09-17
ZDB-ALT-160429-12 ihb127Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:dnbmpr1aa-UTRnanos3) ZDB-TGCONSTRCT-160429-10 2019-09-17
ZDB-ALT-160429-13 ihb128Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:dnghra-UTRnanos3) ZDB-TGCONSTRCT-160429-11 2019-09-17
ZDB-ALT-160429-14 ihb129Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:fgf8a-UTRnanos3) ZDB-TGCONSTRCT-160429-12 2019-09-17
ZDB-ALT-130207-3 ihb12Tg Tg(UAS:bbc3-UTRnanos3,CMV:EGFP)ihb12 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:bbc3-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-130207-3 2019-09-17
ZDB-ALT-160429-15 ihb130Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:lft1-UTRnanos3) ZDB-TGCONSTRCT-160429-13 2019-09-17
ZDB-ALT-160429-16 ihb131Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:ndr1-UTRnanos3) ZDB-TGCONSTRCT-160429-14 2019-09-17
ZDB-ALT-160429-17 ihb132Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:spry2-UTRnanos3) ZDB-TGCONSTRCT-160429-15 2019-09-17
ZDB-ALT-160429-18 ihb133Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:wnt8a-UTRnanos3) ZDB-TGCONSTRCT-160429-16 2019-09-17
ZDB-ALT-160603-3 ihb134 Small Deletion embryos treated with CRISPR1-irf1a deletion of GAGGAACAGATCCAGTCCGGCAGATACCCGGGAGTCCAGTGGCTGGACCAGG in exon 1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-160804-6 ihb135 Indel embryos treated with CRISPR5-tp53 At position 825 bp of the wild-type tp53 coding sequence, G, is mutated into TGATT. The mutated tp53 codes for a truncated protein containing 337 aa, 274 aa of which is identical to wildtype tp53 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-160804-7 ihb136 Small Deletion embryos treated with CRISPR5-tp53 Between 822 bp to 825 bp of the wild-type tp53 coding sequence, GCAG, is deleted. The mutated tp53 codes for a truncated protein containing 364 aa, 273 aa of which is identical to wildtype tp53. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-170111-1 ihb137 Small Deletion embryos treated with CRISPR1-pou5f3 an ACGC deletion at the target sequence Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-170111-2 ihb138 Small Deletion embryos treated with CRISPR1-pou5f3 a CA deletion at 3' terminal of target sequence Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-170327-3 ihb139 Small Deletion embryos treated with CRISPR1-sstr1b Between 286 bp to 304 bp of the wild-type sstr1b coding sequence, ACTTCAGCCGCAGTGCACC, is deleted. The mutated sstr1b codes for a truncated protein containing 121 aa, 95 aa of which is identical to wildtype sstr1b Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-130207-4 ihb13Tg Tg(UAS:bmf1-UTRnanos3,CMV:EGFP)ihb13 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:bmf1-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-130207-4 2019-09-17
ZDB-ALT-170328-1 ihb140 Indel embryos treated with CRISPR1-sstr1b 298bp of the wild-type sstr1b coding sequence, G, is mutated into cattactatttgtttagtaa. The mutated sstr1b codes for a truncated protein containing 125 aa, 99 aa of which is identical to wildtype sstr1b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-161117-6 ihb141 Small Deletion embryos treated with CRISPR2-trpv1 4 bp deleted between 719 bp to 722 bp of the wild-type trpv1 coding sequence, AGAG, is deleted in exon 5. The mutated trpv1 codes for a truncated protein containing 250 aa, of which 813 aa are identical to wildtype trpv1. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-161117-8 ihb142 Indel embryos treated with CRISPR3-trpv1 In 704 bp of the wild-type trpv1 coding sequence, C, is mutated into GAG in exon 5. The mutated trpv1 codes for a truncated protein containing 252 aa, of which 813 aa are identical to wildtype trpv1. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-161117-9 ihb143 Indel embryos treated with CRISPR3-trpv1 Between 702 bp to 703 bp of the wild-type trpv1 coding sequence, GG, is mutated into AAA in exon 5. The mutated trpv1 codes for a truncated protein containing 256 aa, of which 813 aa are identical to wildtype trpv1. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-170420-1 ihb144 Small Deletion embryos treated with TALEN Between 226 bp to 234 bp of the wild-type cyp17a1 coding sequence, TGTATT, is deleted. The mutated cyp17a1 codes for a truncated protein containing 234 aa, of which 519 aa are identical to wildtype cyp17a1 Zhan Yin Lab ZDB-LAB-110330-2 Chr: 13 2019-09-17
ZDB-ALT-170424-4 ihb145 Indel embryos treated with CRISPR In the 149 bp of the wild-type ppp2r3a coding sequence, G, is mutated into TGCTACAGTTGC in exon 1. The mutated ppp2r3a codes for a truncated protein containing 897 aa, of which 1161 aa are identical to wildtype ppp2r3a. Zhan Yin Lab ZDB-LAB-110330-2 Chr: 2 2019-09-17
ZDB-ALT-170502-3 ihb147Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(tg:mCherry) ZDB-TGCONSTRCT-170502-1 2019-09-17
ZDB-ALT-170522-8 ihb148 Small Deletion embryos treated with CRISPR1-igf2a Between 202bp and 208 bp of the wild-type igf2a coding sequence, ACAGA is deleted in exon 3. The mutated igf2a codes for a truncated protein containing 86 aa, of which 197 aa are identical to wildtype igf2a. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-170522-9 ihb149 Small Deletion embryos treated with CRISPR2-igf2a Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-130308-2 ihb14Tg Tg(kop.1:EGFP-UTRnanos3)ihb14 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg1(kop:EGFP-UTR-nanos3) ZDB-TGCONSTRCT-130308-2 2019-09-17
ZDB-ALT-170710-1 ihb150Tg Transgenic Insertion embryos treated with CRISPR Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(kop:KALTA4-UTRnanos3,CMV:EGFPins-SV40) ZDB-TGCONSTRCT-170710-1 2019-09-17
ZDB-ALT-170710-2 ihb151Tg Transgenic Insertion embryos treated with CRISPR Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(kop:KALTA4-UTR-nanos3,CMV:EGFPdel-SV40) ZDB-TGCONSTRCT-170710-2 2019-09-17
ZDB-ALT-170608-4 ihb152 M2 Indel embryos treated with TALEN1-cyp2r1 Mutation results in a 74 amino acid truncated protein. Zhan Yin Lab ZDB-LAB-110330-2 Chr: 7 2019-09-17
ZDB-ALT-170608-5 ihb153 M1 Small Deletion embryos treated with TALEN1-cyp2r1 Mutation results in a truncated 72 amino acid protein. Zhan Yin Lab ZDB-LAB-110330-2 Chr: 7 2019-09-17
ZDB-ALT-170608-7 ihb154 Small Deletion embryos treated with CRISPR1-cldnb Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-170608-8 ihb155 Small Deletion embryos treated with CRISPR1-cebpd Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-170608-9 ihb156 Insertion embryos treated with CRISPR1-cyp11a1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-170608-10 ihb157 Small Deletion embryos treated with CRISPR1-cyp11a1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-170608-11 ihb158 Small Deletion embryos treated with CRISPR1-cyp19a1a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-170608-12 ihb159 Small Deletion embryos treated with CRISPR1-cyp19a1a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-130311-1 ihb15Tg Tg(kop:Krac1-UTRnanos3,CMV:EGFP)ihb15, Tg(kop:rac1_G12V-UTRnanos3,CMV:EGFP)ihb15 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(kop:rac1a_G12V-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-130311-1 2019-09-17
ZDB-ALT-170608-13 ihb160 Small Deletion embryos treated with CRISPR1-fabp10a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-170608-14 ihb161 Small Deletion embryos treated with CRISPR1-fabp10a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-170608-15 ihb162 Small Deletion embryos treated with CRISPR1-foxa3 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-170608-16 ihb163 Small Deletion embryos treated with CRISPR1-foxa3 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-170608-17 ihb164 Small Deletion embryos treated with CRISPR1-ptf1a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-170608-18 ihb165 Insertion embryos treated with CRISPR1-ptf1a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-170608-6 ihb166 Indel embryos treated with CRISPR2-narfl Zhan Yin Lab ZDB-LAB-110330-2 Chr: 3 2019-09-17
ZDB-ALT-170609-5 ihb167 Indel embryos treated with TALEN1-mstnb Between 32bp to 37bp of the wild-type mstnb coding sequence, 6bp is deleted and 26bp is inserted. The mutated mstnb codes for a truncated protein containing 60 aa, of which 1125 aa are identical to wildtype mstnb. Zhan Yin Lab ZDB-LAB-110330-2 Chr: 9 2019-09-17
ZDB-ALT-170609-3 ihb168 Indel embryos treated with CRISPR2-nanog Six nucleotides, CGCCAG, located in the splice donor site of exon 1, and the following 218 nucleotides of intron, are mutated into ACTCGACTCGATAAAAGCAAAGTTTTTTTTAAAG. This mutation may lead to mis-splicing of the nanog transcript, resulting in the use of an alternative donor site (changing the 3’ boundary of the exon 1) or simply the retention of the intron 1. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-170609-4 ihb169 Indel embryos treated with CRISPR1-nanog 621 bp to 626 bp of the wild-type nanog coding sequence, GAATGC, is mutated into CAATCGGTTTGGTCAATCGGACCAA. The mutated nanog codes for a truncated protein containing 220 aa, 206 aa of which is identical to wildtype nanog. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-130312-1 ihb16Tg Tg(-1.9mylpfa:EGFP)ihb16 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(-1.9mylpfa:EGFP) ZDB-TGCONSTRCT-130311-2 2019-09-17
ZDB-ALT-170609-6 ihb170 Small Deletion embryos treated with CRISPR1-igf2b 493bp to 499 bp of the wild-type igf2b coding sequence, 7bp is deleted in exon 4. The mutated igf2b codes for a truncated protein containing 209 aa, of which 212 aa are identical to wildtype igf2b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-170609-7 ihb171 Insertion embryos treated with CRISPR1-igf2b Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-170612-2 ihb172 Small Deletion embryos treated with TALEN1-foxl2a Gui Lab ZDB-LAB-111031-1 Chr: 15 2019-09-17
ZDB-ALT-170811-3 ihb173 Small Deletion embryos treated with TALEN1-foxl2b Gui Lab ZDB-LAB-111031-1 Chr: 2 2019-09-17
ZDB-ALT-170711-6 ihb175Tg Transgenic Insertion embryos treated with DNA Gui Lab ZDB-LAB-111031-1 Unmapped Tg(-1.7apoa2:GFP) ZDB-TGCONSTRCT-120206-1 2019-09-17
ZDB-ALT-170711-7 ihb176Tg Transgenic Insertion embryos treated with DNA Gui Lab ZDB-LAB-111031-1 Unmapped Tg(-1.7apoa2:RFP) ZDB-TGCONSTRCT-170711-4 2019-09-17
ZDB-ALT-170711-8 ihb177Tg Transgenic Insertion embryos treated with DNA Gui Lab ZDB-LAB-111031-1 Unmapped Tg(-1.7apoa2:apo-GFP) ZDB-TGCONSTRCT-170711-5 2019-09-17
ZDB-ALT-170711-9 ihb178Tg Transgenic Insertion embryos treated with DNA Gui Lab ZDB-LAB-111031-1 Unmapped Tg(-1.7-apoa2:apo-RFP) ZDB-TGCONSTRCT-170711-6 2019-09-17
ZDB-ALT-170711-10 ihb179Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(hsp70l:jundn-mCherry) ZDB-TGCONSTRCT-170711-2 2019-09-17
ZDB-ALT-130312-2 ihb17Tg Tg(-4.0tpma:EGFP)ihb17 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(-4.0tpma:EGFP) ZDB-TGCONSTRCT-130312-1 2019-09-17
ZDB-ALT-170717-1 ihb180Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(hsp70l:creb1a_S133A-mCherry) ZDB-TGCONSTRCT-170717-1 2019-09-17
ZDB-ALT-170825-2 ihb181 Insertion embryos treated with CRISPR1-matn3a, CRISPR2-bloc1s2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-170828-2 ihb182 Small Deletion embryos treated with TALEN1-prl Zhan Yin Lab ZDB-LAB-110330-2 Chr: 3 2019-09-17
ZDB-ALT-170828-3 ihb183 Small Deletion embryos treated with TALEN1-prl Zhan Yin Lab ZDB-LAB-110330-2 Chr: 3 2019-09-17
ZDB-ALT-170829-1 ihb184 Small Deletion embryos treated with CRISPR1-tlx1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-170829-2 ihb185 Complex embryos treated with CRISPR2-tlx1 4 bps, CTTG, are deleted and 2 bps are substituted from CG to AC in exon1 of tlx1 genomic DNA. 4 bps deletion from position 246 to 249 ,and 2 bps substitution (CG ->AC) Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-171002-4 ihb186 Insertion embryos treated with CRISPR1-hoxd12a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 9 2019-09-17
ZDB-ALT-171002-5 ihb187 Indel embryos treated with CRISPR1-hoxd12a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 9 2019-09-17
ZDB-ALT-171002-6 ihb188 Insertion embryos treated with CRISPR1-jac9 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-171002-7 ihb189 Insertion embryos treated with CRISPR1-bmp3 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-131023-1 ihb18Tg Tg(UAS:rac1a_G12V-UTR-nanos3,CMV:EGFP)ihb18 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:rac1a_G12V-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-131023-1 2019-09-17
ZDB-ALT-171002-8 ihb190 Small Deletion embryos treated with CRISPR1-bmp3 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-171016-1 ihb191 Small Deletion embryos treated with CRISPR1-jac9 4bps, GAGG, are deleted in exon2 of jac9 genomic DNA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-171016-2 ihb192 Small Deletion embryos treated with CRISPR2-jac9 8bps, atcccacc , are deleted in exon2 of jac9 genomic DNA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-171002-9 ihb193 Indel embryos treated with TALEN2-nr5a2 Between 161bp and 170bp of the wild-type nr5a2 coding sequence, 10bp is deleted and 6bp is inserted in exon 2 . The mutated nr5a2 codes for a truncated protein containing 59 aa, of which 517 aa are identical to wildtype nr5a2. Zhan Yin Lab ZDB-LAB-110330-2 Chr: 22 2019-09-17
ZDB-ALT-171016-3 ihb194 Insertion embryos treated with CRISPR1-irf1a 23bps, TCCCGGGTCCACTCCCAGTGTAC , are inserted in exon1 of irf1a genomic DNA. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-171106-3 ihb195 Small Deletion embryos treated with TALEN2-nr5a2 Between 165bp and 169bp of the wild-type nr5a2 coding sequence, ATATC is deleted in exon 2.The mutated nr5a2 codes for a truncated protein containing 61 aa, of which 517 aa are identical to wildtype nr5a2 Zhan Yin Lab ZDB-LAB-110330-2 Chr: 22 2019-09-17
ZDB-ALT-171113-5 ihb196 Small Deletion embryos treated with CRISPR2-matn3a deletion of ACAGGGA in exon 3 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-171113-6 ihb197 Small Deletion embryos treated with CRISPR2-matn3a deletion of GATGCCAACCAAAACAGGGAAT in exon 3 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-171212-3 ihb198Tg Transgenic Insertion embryos treated with DNA Hong Cao Lab ZDB-LAB-180404-1 Unmapped Tg(fabp10a:Hsa.NRAS_Q61K) ZDB-TGCONSTRCT-180129-2 2019-09-17
ZDB-ALT-180302-14 ihb199 Small Deletion embryos treated with CRISPR1-marcksb 1 bp deletion. "A" is deleted at position 16bp after ATG. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 17 2019-09-17
ZDB-ALT-180319-10 ihb1994 Small Deletion embryos treated with CRISPR1-prmt5 Xiao Lab ZDB-LAB-101011-1 Ambiguous 2019-09-17
ZDB-ALT-180319-11 ihb1995 Small Deletion embryos treated with CRISPR1-prmt5 Xiao Lab ZDB-LAB-101011-1 Ambiguous 2019-09-17
ZDB-ALT-131226-1 ihb19Tg Tg(UAS:Krac1-URTnanos3,CMV:EGFP), Tg(UAS:rac1a_G12V-UTR-nanos3,CMV:EGFP)ihb19 Transgenic Insertion embryos treated with DNA This construct contains a kozak sequence and rac1a V12 which was generated by introducing G12V substitution, driven by the kop promoter. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:rac1a_G12V-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-131023-1 2019-09-17
ZDB-ALT-110607-1 ihb1Tg Tg(-1.0pomca:GFP)ihb1 Transgenic Insertion embryos treated with DNA Zhan Yin Lab ZDB-LAB-110330-2 Unmapped Tg(-1.0pomca:GFP) ZDB-TGCONSTRCT-070802-1 2019-09-17
ZDB-ALT-180302-15 ihb200 Indel embryos treated with CRISPR1-marcksb 7bp deletion, 11bp insertion. 17bp to 23 bp of the wild-type marcksb coding sequence, CCAAAAA, is mutated into GTGAAAGCAAA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 17 2019-09-17
ZDB-ALT-160427-6 ihb2015001 mutant 1 Small Deletion embryos treated with TALEN1-vhl Two nucleotides in exon 1 were deleted in this mutant. Du et al. (2015) Xiao Lab ZDB-LAB-101011-1 Chr: 6 2019-09-17
ZDB-ALT-160427-11 ihb2015002 mutant 2 Insertion embryos treated with TALEN1-vhl Two nucleotides were inserted in exon 1 in this mutant. Du et al. (2015) Xiao Lab ZDB-LAB-101011-1 Chr: 6 2019-09-17
ZDB-ALT-170424-5 ihb2017 Small Deletion embryos treated with TALEN2-tet1 exon3 deletion of TAGCCAGTGC Xiao Lab ZDB-LAB-101011-1 Chr: 13 2019-09-17
ZDB-ALT-170822-13 ihb20170818 Small Deletion embryos treated with CRISPR1-hif1an Xiao Lab ZDB-LAB-101011-1 Chr: 13 2019-09-17
ZDB-ALT-170822-14 ihb20170819 Small Deletion embryos treated with CRISPR2-hif1an Xiao Lab ZDB-LAB-101011-1 Chr: 13 2019-09-17
ZDB-ALT-170424-8 ihb2018 Small Deletion embryos treated with CRISPR1-tet1 exon 9 deleltion of TGTAGGG Xiao Lab ZDB-LAB-101011-1 Chr: 13 2019-09-17
ZDB-ALT-180620-1 ihb20180620 Small Deletion embryos treated with CRISPR2-hif1al Xiao Lab ZDB-LAB-101011-1 Chr: 15 2019-09-17
ZDB-ALT-180620-2 ihb20180621 Insertion embryos treated with CRISPR3-hif1al Xiao Lab ZDB-LAB-101011-1 Chr: 15 2019-09-17
ZDB-ALT-170424-9 ihb2019 Insertion embryos treated with TALEN2-tet2 insertion of CAGA between CTCACCAAGCACCAAAATGGAGATCAG and TCACCCGAAGTCTTGTCTCAGCAG Xiao Lab ZDB-LAB-101011-1 Chr: 1 2019-09-17
ZDB-ALT-131118-7 ihb201Gt Gt(IRES:EGFP,LOXP-Oni.Hsp70:SB11-LOXP)ihb201, ihb201Tg Transgenic Insertion embryos treated with DNA Gene-Trap cassette has landed in the intron7 of mamdc2a gene. Cui Lab ZDB-LAB-131112-1 Unmapped Gt(IRES:EGFP,LOXP-Oni.Hsp70:SB11-LOXP) ZDB-GTCONSTRCT-131118-1 2019-09-17
ZDB-ALT-170424-10 ihb2020 Insertion embryos treated with TALEN2-tet3 exon 2 insertion of T between TATTAAACCAGGAACTCTCTAATGGGC and TTAGCAAACATGCATCTAATGAAGA Xiao Lab ZDB-LAB-101011-1 Chr: 5 2019-09-17
ZDB-ALT-151123-1 ihb202Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA The transgenic insertion into exon 2 causes a 10 bp deletion. Transcription is interrupted. Cui Lab ZDB-LAB-131112-1 Chr: 21 Tg(CMV:TETAM2) ZDB-TGCONSTRCT-151123-1 2019-09-17
ZDB-ALT-151123-2 ihb203Tg Transgenic Insertion embryos treated with DNA Cui Lab ZDB-LAB-131112-1 Unmapped Tg(TETRE:EGFP,gtf2b) ZDB-TGCONSTRCT-151123-2 2019-09-17
ZDB-ALT-180302-3 ihb204Et ihb204Tg, pTME2 Transgenic Insertion embryos treated with DNA Cui Lab ZDB-LAB-131112-1 Unmapped Et(Mmu.Mt1:EGFP-SA-STOP) ZDB-ETCONSTRCT-180302-2 2019-09-17
ZDB-ALT-180302-4 ihb205Et ihb205Tg, pTME3 Transgenic Insertion embryos treated with DNA Cui Lab ZDB-LAB-131112-1 Unmapped Et(Mmu.Mt1:EGFP-SA-STOP) ZDB-ETCONSTRCT-180302-2 2019-09-17
ZDB-ALT-180302-10 ihb206Et pTME9 Transgenic Insertion embryos treated with DNA Cui Lab ZDB-LAB-131112-1 Unmapped Et(Mmu.Mt1:EGFP-SA-STOP) ZDB-ETCONSTRCT-180302-2 2019-09-17
ZDB-ALT-180302-11 ihb207Et pTME10 Transgenic Insertion embryos treated with DNA Cui Lab ZDB-LAB-131112-1 Unmapped Et(Mmu.Mt1:EGFP-SA-STOP) ZDB-ETCONSTRCT-180302-2 2019-09-17
ZDB-ALT-180302-13 ihb208Et pTME12 Transgenic Insertion embryos treated with DNA Cui Lab ZDB-LAB-131112-1 Unmapped Et(Mmu.Mt1:EGFP-SA-STOP) ZDB-ETCONSTRCT-180302-2 2019-09-17
ZDB-ALT-180307-5 ihb209 Small Deletion embryos treated with CRISPR1-ifng1r Between 155 bp to 159 bp of the wild-type ifng1r coding sequence, AAAGG, is deleted. The mutated ifng1r codes for a truncated protein containing 68 aa, 51 aa of which is identical to wildtype ifng1r. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 4 2019-09-17
ZDB-ALT-131226-2 ihb20Tg Tg2(mpeg1:EGFP)ihb20 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg2(mpeg1:EGFP) ZDB-TGCONSTRCT-131226-1 2019-09-17
ZDB-ALT-180307-6 ihb210 Small Deletion embryos treated with CRISPR1-ifng1r 159 bp to 162 bp of the wild-type ifng1r coding sequence, GATT, is deleted. The mutated ifng1r codes for a truncated protein containing 66 aa, 53 aa of which is identical to wildtype ifng1r. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 4 2019-09-17
ZDB-ALT-180314-5 ihb211 Indel embryos treated with CRISPR1-stat3 138 bp to 165 bp of the wild-type stat3 coding sequence, GGCCAACAAGGAGTCTCACGCCACGCTG, is mutated into aatctaaatataattctacttaatcacttccaaaaccttaatcactttttaacttttaactgcaggagg. Additionally, between 251 and 252 bp of the downstream coding sequence, cacaacctgcg is inserted. The mutated stat3 codes for a truncated protein containing 47 aa, 46 aa of which is identical to wildtype stat3. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 3 2019-09-17
ZDB-ALT-180314-6 ihb212 Small Deletion embryos treated with CRISPR1-stat3 Between 139 bp to 146 bp of the wild-type stat3 coding sequence, GCCAACAA, is deleted. The mutated stat3 codes for a truncated protein containing 166 aa, 46 aa of which is identical to wildtype stat3. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 3 2019-09-17
ZDB-ALT-180314-7 ihb213 Indel embryos treated with CRISPR1-kita 621 bp of the wild-type kita coding sequence, G, is mutated into TCC. The mutated kita codes for a truncated protein containing 247 aa, 206 aa of which is identical to wildtype kita Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-180314-8 ihb214 Small Deletion embryos treated with CRISPR1-kita Between 622 bp to 626 bp of the wild-type kita coding sequence, ATCAC, is deleted. The mutated kita codes for a truncated protein containing 283 aa, 207 aa of which is identical to wildtype kita. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-180319-2 ihb215 Small Deletion embryos treated with CRISPR1-aurka bp number 273 of the wild-type aurka coding sequence, G, is deleted. The mutated aurka codes for a truncated protein containing 214 aa, 90 aa of which is identical to wildtype aurka. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-180319-3 ihb216 Indel embryos treated with CRISPR1-aurka Between 274 bp to 278 bp of the wild-type aurka coding sequence, CTGTC, is mutated into G. The mutated aurka codes for a truncated protein containing 213 aa, 91 aa of which is identical to wildtype aurka Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-180319-4 ihb217 Insertion embryos treated with CRISPR1-ikzf4 Between 180 bp and 181 bp of the wild-type ikzf4 coding sequence, GGATTTGATGGAGTTATTTG, is inserted. The mutated ikzf4 codes for a truncated protein containing 74 aa, 60 aa of which is identical to wildtype ikzf3. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 23 2019-09-17
ZDB-ALT-180319-5 ihb218 Indel embryos treated with CRISPR1-ikzf4 Between 175 bp to 180 bp of the wild-type ikzf4 coding sequence, AGTGAC, is mutated into G. The mutated ikzf4 codes for a truncated protein containing 75 aa, 58 aa of which is identical to wildtype ikzf4. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 23 2019-09-17
ZDB-ALT-180319-6 ihb219 Small Deletion embryos treated with CRISPR1-fads2 291 bp to 301 bp of the wild-type fads2 coding sequence, TGAACCCAGTC, is deleted. The mutated fads2 codes for a truncated protein containing 113 aa, 96 aa of which is identical to wildtype fads2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-131226-3 ihb21Tg Tg2(mpeg1:mCherry)ihb21 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg2(mpeg1:mCherry) ZDB-TGCONSTRCT-131226-2 2019-09-17
ZDB-ALT-180319-7 ihb220 Small Deletion embryos treated with CRISPR1-fads2 Between 300 bp to 303 bp of the wild-type fads2 coding sequence, TCAG, is deleted. The mutated fads2 codes for a truncated protein containing 126 aa, 100 aa of which is identical to wildtype fads2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-180319-8 ihb221 Insertion embryos treated with CRISPR2-myo7aa Between 218 bp and 219 bp of the wild-type myo7aa coding sequence, CTGAAT, is inserted. The mutated myo7aa codes for a truncated protein containing 73 aa, 72 aa of which is identical to wildtype myo7aa Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-180319-9 ihb222 Indel embryos treated with CRISPR2-myo7aa Between 216 bp to 223 bp of the wild-type myo7aa coding sequence, GCTGGGGG, is mutated into A. The mutated myo7aa codes for a truncated protein containing 73 aa, 72 aa of which is identical to wildtype myo7aa. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-180410-4 ihb223 Small Deletion embryos treated with TALEN1-tdrd12 16bp deletion from position 74bp to 90bp after ATG Zhan Yin Lab ZDB-LAB-110330-2 Chr: 25 2019-09-17
ZDB-ALT-180419-1 ihb224 Indel embryos treated with CRISPR 433 bp to 437 bp of the wild-type P2rx7 coding sequence, GTGAA, is mutated into T. The mutated P2rx7 codes for a truncated protein containing 148 aa, 144 aa of which is identical to wildtype P2rx7 Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-180419-2 ihb225 Indel embryos treated with CRISPR Between 437 bp to 441 bp of the wild-type P2rx7 coding sequence, AGTTG, is mutated into GATACTAAA. The mutated P2rx7 codes for a truncated protein containing 147 aa, 145 aa of which is identical to wildtype P2rx7. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-180517-10 ihb226 Small Deletion embryos treated with CRISPR1-ppm1da >WT CGAGCAAGTATTTATTACGACCAGGGCGGTCGGAAATACATGGAGGACCTAGTAACGATGAAGCAGGAGGATGAGCCG > ihb226 CGAGCAAGTATTTATTACGACCAGGGCGGACCTAGTAACGATGAAGCAGGAGGATGAGCCG Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 15 2019-09-17
ZDB-ALT-180517-11 ihb227 Insertion embryos treated with CRISPR2-ppm1da >WT AAAAACAGTTACAGGACTCCCTAGCACATCGGGCACAACTGCAAGTATTGTGGTATTAAGACGTGACCGTA > ihb227 AAAAACAGTTACAGGACTCCCTAGCACATCGGGCACAACTGCAAGTATTAAGACGTGGTATTAAGACGTGACCGTA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 15 2019-09-17
ZDB-ALT-180517-12 ihb228 Indel embryos treated with CRISPR3-prmt5 >WT ATTGGAACACTCTTATCGTGGGAAAGCTGTCACCCTGGATTGAGACTGACTCCGAGTTGACCACAGAGCGCA > ihb228 ATTGGAACACTCTTATCGTGGGAAAGCTGTCACCCTGGACTGACTGACTCCGAGTTGACCACAGAGCGCA Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-180517-13 ihb229 Indel embryos treated with CRISPR3-prmt5 >WT ATTGGAACACTCTTATCGTGGGAAAGCTGTCACCCTGGATTGAGACTGACTCCGAGTTGACCACAGAGCGCA > ihb229 ATTGGAACACTCTTATAGTGGGAAAGCTGTCACCCTGTCACCCTTGAGACTGACTCCAACTTGACCACAGAGCGCA Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-140123-1 ihb22Tg Tg(CMV:Cel.Fat1,CMV:EGFP)ihb22 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(CMV:Cel.Fat1,CMV:EGFP) ZDB-TGCONSTRCT-140121-1 2019-09-17
ZDB-ALT-180517-14 ihb230 Small Deletion embryos treated with CRISPR1-col1a2 >WT GGTCTTCCTGGAATTGCTGGTGCCCCTGGTTTCCCTGGCCCTAGAGGAGGCCCTGGCCCACAGGGACCTAGTGGAGCTTCTGGTCCAAGAGGTCTTGG > ihb226 GGTCTTCCTGGAATTGCTGGTGCCCCTGGTTTCCCTGGCCCTAGGAGGCCCTGGCCCACAGGGACCTAGTGGAGCTTCTGGTCCAAGAGGTCTTGG Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 19 2019-09-17
ZDB-ALT-180517-15 ihb231 Small Deletion embryos treated with CRISPR1-cd44a >WT CAGTCGTTACTCTCTTACCTTTCAGAAGGCTGGTGAACTGTGTCAGAGTTTAGGTTACAGACTTGCAACACAAGAACAGGTCACTGAAGCCTATAAAAAAGGC > ihb231 CAGTCGTTACTCTCTTACCTTTCAGAAGGCTGGTGAACTGTGTCAGAGGTTACAGACTTGCAACACAAGAACAGGTCACTGAAGCCTATAAAAAAGGC Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-180517-16 ihb232 Insertion embryos treated with CRISPR1-cd44a >WT CAGTCGTTACTCTCTTACCTTTCAGAAGGCTGGTGAACTGTGTCAGAGTTTAGGTTACAGACTTGCAACACAAGAACAGGTCACTGAAGCCTATAAAAAAGGC > ihb232 CAGTCGTTACTCTCTTACCTTTCAGAAGGCTGGTGAACTGTGTCAGAGGTTTAGGTTACAGACTTGCAACACAAGAACAGGTCACTGAAGCCTATAAAAAAGGC Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-180517-17 ihb233 Indel embryos treated with CRISPR1-ucp2 >WT ACAAAATCTGCCCCCACAGAAGATTTCCACAGATTCACTGTACATTTACAATATTGCTGCCTTAAATTATTTAGT > ihb233 ACAAAATCTGCACCCACAGATTCACTGTACATTTACAATATTGCTGCCTTAAATTATTTAGT Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-180517-18 ihb234 Small Deletion embryos treated with CRISPR1-ucp2 >WT ACAAAATCTGCCCCCACAGAAGATTTCCACAGATTCACTGTACATTTACAATATTGCTGCCTTAAATTATTTAGTTCAATTAAAGGAACTTTTCTAGTCATCTCAACTTGCATCAG > ihb234 ACAAAATCTGCCCCCACAGAAGATTTCCACAGATTCACTGTACATTTACAATATTGCTGCCTTAAATTATTTAGTTCAATTAAAGGAACTTTCTAGTCATCTCAACTGCATCAG Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-180517-19 ihb235 Small Deletion embryos treated with CRISPR1-slc15a1b >WT TCCTGTACTTCAAGTATTTCATTGGTTGGGATGATGACCTGTCCACCACCATCTACCACACGTTTGTGGCTCTCTGCTACCTTACACCCATCATGGGAGCCATTA > ihb235 TCCTGTACTTCAAGTATTTCATTGGTTGGGATGATGACCTGTCACCACCATCTACCACACGTTTGTGGCTCTCTGCTACCTTACACCCATCATGGGAGCCATTA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-180517-20 ihb236 Insertion embryos treated with CRISPR1-slc15a1b >WT TCCTGTACTTCAAGTATTTCATTGGTTGGGATGATGACCTGTCCACCACCATCTACCACACGTTTGTGGCTCTCTGCTACCTTACACCCATCATGGGAGCCATTA > ihb236 TCCTGTACTTCAAGTATTTCATTGGTTGGGATGATGACCTGTCATCACCACCATCTACCACACGTTTGTGGCTCTCTGCTACCTTACACCCATCATGGGAGCCATTA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-180517-21 ihb237 Small Deletion embryos treated with CRISPR1-oca2 >WT TCTGGCTGCAATGTTAGGATCCCTGTCTGCTCTGGCAGCTCTGGCTTTCATTGGAGAT > ihb237 TCTGGCTGCAATGTTAGGATCCCTGTCTGCTCTGGCAGCTCTGGCTTTGGAGAT Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-180517-22 ihb238 Small Deletion embryos treated with CRISPR1-oca2 >WT TCTGGCTGCAATGTTAGGATCCCTGTCTGCTCTGGCAGCTCTGGCTTTCATTGGAGAT > ihb238 TCTGGCTGCAATGTTAGGATCCCTGTCTGCTCTGGCAGCTCTGGCTTGGAGAT Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-180517-23 ihb239 Small Deletion embryos treated with CRISPR1-izumo1 >WT TTTGTAGATTCTCTTCAATGGGATTTGATTACTATAGTGGAGAAAGGAAAAAGAAT > ihb239 TTTGTAGATTCTCTTCAATGGGATTTGATTACTAGTGGAGAAAGGAAAAAGAAT Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 8 2019-09-17
ZDB-ALT-140123-2 ihb23Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(CMV:Cel.Fat2,CMV:mCherry) ZDB-TGCONSTRCT-151019-1 2019-09-17
ZDB-ALT-140606-1 ihb24 Small Deletion embryos treated with TALEN This mutant contains a deletion from bp299 to 303 of the wildtype tbr1b coding sequence, CTGCA, is deleted. The mutated tbr1b codes for a protein containing 220 aa, in which only the sequence of the first 100 aa is identical to wildtype Tbr1b. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-180517-24 ihb240 Indel embryos treated with CRISPR1-izumo1 >WT TTTGTAGATTCTCTTCAATGGGATTTGATTACTATAGTGGAGAAAGGAAAAAGAAT > ihb240 TTTGTAGATTCTCTTCAATGGGATTTGATAGTGGAGAAAGGAAAAAGAATTCTTCAGAAACACTTGGAGAAAAAGAAT Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 8 2019-09-17
ZDB-ALT-180517-8 ihb241 Small Deletion embryos treated with CRISPR2-lbx2 457 bp to 458 bp of the wildtype lbx2 coding sequence, CC, is deleted. The mutated lbx2 codes for a truncated protein containing 153 aa, 152 aa of which is identical to wildtype lbx2. Zhan Yin Lab ZDB-LAB-110330-2 Chr: 14 2019-09-17
ZDB-ALT-180517-1 ihb242 Small Deletion embryos treated with CRISPR 2bp of “AG” deleted from position 110bp exon2 of the wild-type timp3 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-180517-2 ihb243 Small Deletion embryos treated with CRISPR 4bp of “AGAG” deleted from position 106bp exon2 of the wild-type timp3 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-180604-2 ihb244 Insertion embryos treated with CRISPR1-csrp3 Between 216 bp to 217 bp of the wild-type csrp3 coding sequence, G is inserted in exon 3. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-180604-3 ihb245 Small Deletion embryos treated with CRISPR1-csrp3 Between 211 bp to 217 bp of the wild-type csrp3 coding sequence, TATGGGT is deleted in exon 3. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-180604-4 ihb246 Indel embryos treated with CRISPR1-msx3 Between 297 bp to 305 bp of the wild-type msx3 coding sequence, AGTGGAGAG is mutated to TATCTGCGTAAAGCGACACACTACA in exon 1. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-180604-5 ihb247 Indel embryos treated with CRISPR1-nfe2l2a Between 217 bp to 222 bp of the wild-type nfe2l2a coding sequence, CTGCAG is mutated to GAGGA in exon 2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 9 2019-09-17
ZDB-ALT-180604-6 ihb248 Indel embryos treated with CRISPR5-esr1 Between 580 bp to 581 bp of the wild-type esr1 coding sequence, TG is mutated to CGAC in exon 4. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-180604-7 ihb249 Indel embryos treated with CRISPR1-klf2b Between 655 bp to 661 bp of the wild-type klf2b coding sequence, GCGTATC is mutated to TGA in exon 2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-140606-2 ihb25 Indel embryos treated with TALEN 133 bp to 136 bp of the wildtype lhx1a coding sequence, CGAG, is mutated into GTT. The mutated lhx1a codes for a protein containing 85 aa, in which only the sequence of the first 44 aa is identical to wildtype Lhx1a. The homozygous mutants die in the larvae stage. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 15 2019-09-17
ZDB-ALT-180604-8 ihb250 Indel embryos treated with CRISPR1-klf2b Between 737 bp to 738 bp of the wild-type klf2b coding sequence, TG is mutated to ACC in exon 2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-180604-9 ihb251 Indel embryos treated with CRISPR1-lepr Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-180604-10 ihb252 Small Deletion embryos treated with CRISPR1-lepr Between 917 bp to 920 bp of the wild-type lepr coding sequence, ACCG is deleted in exon 8. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 6 2019-09-17
ZDB-ALT-180604-11 ihb253 Small Deletion embryos treated with CRISPR1-fndc5b Between 169 bp to 176 bp of the wild-type fndc5b coding sequence, GTCATTGG is deleted in exon 2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 19 2019-09-17
ZDB-ALT-180604-12 ihb254 Indel embryos treated with CRISPR1-fndc5b Between 169 bp to 170 bp of the wild-type fndc5b coding sequence, GT is mutated to TCCAGGAAAC in exon 2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 19 2019-09-17
ZDB-ALT-180612-1 ihb255Gt This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA Cui Lab ZDB-LAB-131112-1 Ambiguous Gt(GBT-rp2) ZDB-GTCONSTRCT-111117-2 2019-09-17
ZDB-ALT-180629-2 ihb256 Small Deletion embryos treated with CRISPR1-nfe2l2a Between 415bp to 419 bp of the wild-type nfe2l2a coding sequence, GCCTT is deleted in exon 4. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 9 2019-09-17
ZDB-ALT-180629-1 ihb257 Small Deletion embryos treated with CRISPR1-sdc4 In the 98 bp of the wild-type sdc4 coding sequence, A is deleted in exon 2. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-180727-1 ihb258 Small Deletion embryos treated with CRISPR2-nf1a 5 bps, CGCAG, are deleted in the last exon Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 15 2019-09-17
ZDB-ALT-180727-2 ihb259 Small Deletion embryos treated with CRISPR2-nf1a 31bps, AGCCAGGTGCAGAAGCAGCGCAGCGCAGGCA, are deleted in the last exon Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 15 2019-09-17
ZDB-ALT-140606-3 ihb26 Small Deletion embryos treated with TALEN 299 bp to 305 bp of the wildtype tbr1b coding sequence, CTGCAGG, is deleted. The mutated tbr1b codes for a protein containing 100 aa, and the sequence of the 100 aa is identical to wildtype Tbr1b. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-180727-3 ihb260 Indel embryos treated with CRISPR1-cd36 TTGTGC in exon3 are mutated to GTGTGTGC Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 4 2019-09-17
ZDB-ALT-180727-4 ihb261 Small Deletion embryos treated with CRISPR1-cd36 7bps, TTGTGCT, are deleted in exon3 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 4 2019-09-17
ZDB-ALT-180727-5 ihb262 Indel embryos treated with CRISPR1-slc17a5 GGGTTGG in exon2 are mutated to GATGGC. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-180727-6 ihb263 Insertion embryos treated with CRISPR1-slc17a5 16bps, TTGTGGCATATGCCCT, are inserted in exon2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-180727-7 ihb264 Small Deletion embryos treated with CRISPR1-nell2a 2bps, CG, are deleted in exon17 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-180727-8 ihb265 Small Deletion embryos treated with CRISPR1-nell2a 5bps, GTGCG, are deleted in exon17 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-180727-9 ihb266 Small Deletion embryos treated with CRISPR1-nr1h3 1bps, A, are deleted in exon4 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-180727-10 ihb267 Indel embryos treated with CRISPR1-nr1h3 GTGACAGTGAAGA in exon4 are mutated to CTGGGCCCTTCTCT Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-180727-11 ihb268 Small Deletion embryos treated with CRISPR1-pign 11bps, TCTGCCCCCTC, are deleted in exon2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-180727-12 ihb269 Small Deletion embryos treated with CRISPR1-pign 5bps, CCTCC, are deleted in exon2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-180727-13 ihb270 Indel embryos treated with CRISPR1-dync1h1 CTGCTGGAAGATGG in exon1 is mutated to ATGCTGG Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 17 2019-09-17
ZDB-ALT-180727-14 ihb271 Insertion embryos treated with CRISPR1-dync1h1 TCCGAAA are inserted in exon1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 17 2019-09-17
ZDB-ALT-180727-15 ihb272 Insertion embryos treated with CRISPR2-pink1 GGATT are inserted in exon2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 23 2019-09-17
ZDB-ALT-180727-16 ihb273 Small Deletion embryos treated with CRISPR2-pink1 14bps, TGGAAGATTATGTG, are deleted in exon2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 23 2019-09-17
ZDB-ALT-180815-9 ihb274 Small Deletion embryos treated with CRISPR1-nipbla 4bp deletion. 4bp of “ACGT” deletion from position 81bp exon3 of the wild-type nipbla coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-180815-10 ihb275 Indel embryos treated with CRISPR1-nipbla 5bp deletion, 6bp insertion. 143bp to 148 bp of the wild-type nipbla coding sequence, CGTGG, is mutated into GCATCT Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-180815-11 ihb276 Insertion embryos treated with CRISPR2-nipbla 5bp insertion. 5bp of “CAGCT” insertion from position 31bp exon16 of the wild-type nipbla coding sequence Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-180815-12 ihb277 Indel embryos treated with CRISPR2-nipbla 15bp deletion, 7bp insertion. 27bp to 43 bp of the wild-type nipbla exon16 coding sequence, CTCTGGCGTGATCTC, is mutated into GCATGTG Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-180815-13 ihb278 Small Deletion embryos treated with CRISPR1-nipblb 1bp deletion. 1bp of “G” deletion from position 19bp exon3 of the wild-type nipblb coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-180815-14 ihb279 Insertion embryos treated with CRISPR2-nipblb 19bp inserted. 19bp of “CCTCTACCTTAAATCAGCT” insertion from position 31bp exon3 of the wild-type nipblb coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-140616-1 ihb27Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(OTM:GFP) ZDB-TGCONSTRCT-140611-2 2019-09-17
ZDB-ALT-180815-15 ihb280 Small Deletion embryos treated with CRISPR2-nipblb 4bp deletion. 4bp of “CATG” deletion from position 91bp exon15 of the wild-type nipblb coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-180815-16 ihb281 Small Deletion embryos treated with CRISPR2-nipblb 18bp deletion. 18bp of “TGGGCATCATGCATAAGG” deletion from position 90bp exon15 of the wild-type nipblb coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-180817-2 ihb282 Small Deletion embryos treated with CRISPR1-slc7a14a 71bps, GGCACCAAACTGGCCCGTGTCCTCTCCACCGTGGACCTTGTGTCTCTGGGAGTGGGAAGCTGTGTGGGTAC, are deleted in exon4 of slc7a14a genomic DNA. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-180817-3 ihb283 Small Deletion embryos treated with CRISPR2-slc7a14a 8bps, TCACGGC and C, are deleted in exon4 of slc7a14a genomic DNA. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-180911-1 ihb284 Indel embryos treated with CRISPR1-cyp11c1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-180911-2 ihb285 Small Deletion embryos treated with CRISPR1-cyp11c1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-181009-1 ihb286 Indel embryos treated with CRISPR2-hsf1 Between 413 bp to 420 bp of the wild-type hsf1 coding sequence, GGCCAGTT, is mutated into A. The mutated hsf1 codes for a truncated protein containing 153 aa, 137 aa of which is identical to wildtype hsf1. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 19 2019-09-17
ZDB-ALT-181009-2 ihb287 Small Deletion embryos treated with CRISPR2-hsf1 Between 418 bp to 422 bp of the wild-type hsf1 coding sequence, GTTTT, is deleted. The mutated hsf1 codes for a truncated protein containing 233 aa, 139 aa of which is identical to wildtype hsf1. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 19 2019-09-17
ZDB-ALT-181106-10 ihb288 Insertion embryos treated with CRISPR1-bbc3 Between 60 bp to 61 bp of the wild-type bbc3 coding sequence, G is inserted. The mutated bbc3 codes for a truncated protein containing 63 aa, 20 aa of which is identical to wildtype bbc3. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 15 2019-09-17
ZDB-ALT-181106-11 ihb289 Indel embryos treated with CRISPR1-bbc3 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 15 2019-09-17
ZDB-ALT-140616-2 ihb28Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(BMPRE:GFP) ZDB-TGCONSTRCT-140611-3 2019-09-17
ZDB-ALT-140611-2 ihb29 Insertion embryos treated with TALEN1-socs1a Between the 314 bp and 315 bp of the wildtype socs1a coding sequence, a cytosine(C), is inserted. The mutated socs1a codes for a protein containing 118 aa, in which only the sequence of the first 22 aa is identical to wildtype socs1a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 3 2019-09-17
ZDB-ALT-181112-3 ihb290 Small Deletion embryos treated with CRISPR1-rnf185 163 bp to 166 bp of the wild-type rnf185 coding sequence, CTGT, is deleted. The mutated rnf185 codes for a truncated protein containing 67 aa, 54 aa of which is identical to wildtype rnf185. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-181112-4 ihb291 Indel embryos treated with CRISPR1-rnf185 Between 150 bp to 165 bp of the wild-type rnf185 coding sequence, TGCTGTCATCAGTCTG, is mutated into CA. The mutated rnf185 codes for a truncated protein containing 69 aa, 49 aa of which is identical to wildtype rnf185. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-181112-5 ihb292 Small Deletion embryos treated with CRISPR1-slc39a6 Between 168 bp to 194 bp of the wild-type slc39a6 coding sequence, TTCAGTGGGGGCGGGTTCAGACTGCAA, is deleted. The mutated slc39a6 codes for a truncated protein containing 55 aa, 55 aa of which is identical to wildtype slc39a6. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-181112-6 ihb293 Small Deletion embryos treated with CRISPR1-slc39a6 Between 179 bp to 182 bp of the wild-type slc39a6 coding sequence, CGGG, is deleted. The mutated slc39a6 codes for a truncated protein containing 73 aa, 59 aa of which is identical to wildtype slc39a6. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-181106-12 ihb294 Small Deletion embryos treated with CRISPR2-hsf1 Ihb294: Between 412 bp to 421 bp of the wild-type hsf1 coding sequence, TGGCCAGTTT, is deleted. The mutated hsf1 codes for a truncated protein containing 152 aa, 133 aa of which is identical to wildtype hsf1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 19 2019-09-17
ZDB-ALT-181119-3 ihb295 Small Deletion embryos treated with CRISPR4-esr2a Between 281 bp to 285 bp of the wild-type esr2a coding sequence, CTCAC, is deleted. The mutated esr2a codes for a truncated protein containing 113 aa, 93 aa of which is identical to wildtype esr2a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-190114-1 ihb296 Insertion embryos treated with CRISPR2-jag2b Between 282 bp to 283 bp of the wild-type esr2a coding sequence, GC, is inserted. The mutated esr2a codes for a truncated protein containing 137 aa, 94 aa of which is identical to wildtype esr2a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-181112-7 ihb297 Small Deletion embryos treated with CRISPR3-aldh7a1 Between 334bp to 335 bp of the wild-type aldh7a1 coding sequence, AG is deleted in exon 4. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-181112-8 ihb298 Small Deletion embryos treated with CRISPR3-aldh7a1 Between 334bp to 337 bp of the wild-type aldh7a1 coding sequence, AGAG is deleted in exon 4.
1. CRISPR/TALEN Sequence: gGTACCTGCTCCAAAGAGAG Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-181119-1 ihb299 Small Deletion embryos treated with CRISPR1-hsp90ab1 5bp of “CCTAC” deletion from position 52bp exon 3 of the wild-type hsp90ab1 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-110721-5 ihb2Tg Tg(CMV:Mmu.Jun-Ssc.Ghr)ihb2 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(CMV:Mmu.Jun-Ssc.Ghr) ZDB-TGCONSTRCT-110721-5 2019-09-17
ZDB-ALT-140611-3 ihb30 Indel embryos treated with TALEN This mutant contains a deletion from bp24 to 36 of the wildtype socs2 coding sequence, CACGGAAAGCATC, is deleted. The mutated socs2 codes for a protein containing 31 aa, in which only the sequence of the first 8 aa is identical to wildtype socs2. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-181119-2 ihb300 Small Deletion embryos treated with CRISPR1-hsp90ab1 4bp of “GCCT” deletion from position 51bp exon 3 of the wild-type hsp90ab1 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-140929-1 ihb301Tg Transgenic Insertion sperm treated with DNA Zhan Yin Lab ZDB-LAB-110330-2 Unmapped Tg(cga:EGFP) ZDB-TGCONSTRCT-140929-1 2019-09-17
ZDB-ALT-151202-1 ihb302Tg Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(-2.3kiss1:mCherry) ZDB-TGCONSTRCT-151201-1 2019-09-17
ZDB-ALT-151202-2 ihb303Tg Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(-1.5kiss2:kiss2-mCherry) ZDB-TGCONSTRCT-151201-2 2019-09-17
ZDB-ALT-170614-1 ihb304Tg Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(gad1b:mCherry) ZDB-TGCONSTRCT-170614-1 2019-09-17
ZDB-ALT-180319-1 ihb305Tg Transgenic Insertion embryos treated with DNA Wei Hu lab ZDB-LAB-110815-1 Unmapped Tg(CMV:GFP,CMV:mettl3) ZDB-TGCONSTRCT-180319-1 2019-09-17
ZDB-ALT-180320-8 ihb306 Indel embryos treated with TALEN1-mettl3 The mutation resulted in an open reading frame-shift and caused a truncated protein. The protein lost the catalytic DPPW motif and S-adenosylmethionine (SAM) binding domain. Western blot analysis showed that Mettl3 protein was completely abolished in the mutant. Wei Hu lab ZDB-LAB-110815-1 Chr: 7 2019-09-17
ZDB-ALT-180320-9 ihb307 Small Deletion embryos treated with TALEN1-mettl3 The mutation resulted in an open reading frame-shift and caused a truncated protein. The protein lost the catalytic DPPW motif and S-adenosylmethionine (SAM) binding domain.Western blot analysis showed that Mettl3 protein was completely abolished in the mutant. Wei Hu lab ZDB-LAB-110815-1 Chr: 7 2019-09-17
ZDB-ALT-180816-5 ihb308 Small Deletion embryos treated with TALEN1-sinhcafl, TALEN2-sinhcafl Wei Hu lab ZDB-LAB-110815-1 Ambiguous 2019-09-17
ZDB-ALT-181126-4 ihb309 Small Deletion embryos treated with CRISPR2-ret 5bp deleted，5bp of “TATCA” deletion from position 83bp exon 4 of the wild-type ret coding sequence Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-140611-4 ihb31 Small Deletion embryos treated with TALEN1-socs3a This mutant contains a deletion from bp221 to 281 of the wildtype socs3a coding sequence, CGGCCTGTTTGACGCTAGCATGCGGCTGCCGTTTTACCACTTCAAGACCTTCAGCTCCAAG, is deleted. The mutated socs3a codes for a protein containing 44 aa, in which only the sequence of the first 12 aa is identical to wildtype socs3a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 3 2019-09-17
ZDB-ALT-181126-5 ihb310 Indel embryos treated with CRISPR2-ret 8bp deletion, 1bp insertion. 79bp to 87 bp of the wild-type ret exon 4 coding sequence, AGTGTATC, is mutated into T. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-181129-6 ihb311 Insertion embryos treated with CRISPR1-csnk1a1 35bp inserted, 35bp of "TGGCTGTAAACAACAGTAAACAACGATTCAAACAA" insertion from position 533bp exon1 of wild-type csnk1a1 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-181129-7 ihb312 Insertion embryos treated with CRISPR1-csnk1a1 7bp inserted, 7bp of "GGCAGGC" insertion from position 533bp exon1 of wild-type csnk1a1 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-181129-8 ihb313 Indel embryos treated with CRISPR1-sult2st3 12bp inserted and 1bp deleted, 12bp of "GATAGGGCCCCG" insertion ang 1bp of "C" deletion from position 95bp exon2 of wild-type sult2st3 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-181129-9 ihb314 Small Deletion embryos treated with CRISPR1-sult2st3 4bp deleted, 4bp of "CTGG" deletion from position 95bp exon2 of wild-type sult2st3 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-181129-10 ihb315 Small Deletion embryos treated with CRISPR1-tcf7l1b 11bp deleted, 11bp of "CGGAGGGGACG" deletion from position 20bp exon1 of wild-type tcf7l1b coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-181129-11 ihb316 Small Deletion embryos treated with CRISPR2-tcf7l2 10bp deleted, 10bp of "ACGATCTGGG" deletion from position 936bp exon1 of wild-type tcf7l2 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-181129-12 ihb317 Insertion embryos treated with CRISPR1-cyp11a2 7bp inserted, 7bp of "TGGATCA" insertion from position 650bp exon1 of wild-type cyp11a2 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-181129-13 ihb318 Small Deletion embryos treated with CRISPR1-cyp11a2 17bp deleted, 17bp of "CTGGAGTCTGTCGGCCC" deletion from position 633bp exon1 of wild-type cyp11a2 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-181218-12 ihb319 Insertion embryos treated with CRISPR1-tnfrsf1a >WT AGATGCTGAAAGTTTGGAGTGATGGTGGCAGTGGAGGAGGGAACAATGTTGTGCCGTATGACCAAATCCAGA > ihb319 AGATGCTGAAAGTTTGGAGTGATGGTGGCAGGGAACAATGGAGGAGGGAACAATGTTGTGCCGTATGACCAAATCCAGA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-140611-5 ihb32 Indel embryos treated with TALEN This mutant contains a deletion from bp498 to 505 of the wildtype socs3b coding sequence, GAAGGAGG, is deleted. And an insertion from bp502 to 505(TGGC) in the deleted sequences. The mutated socs3b codes for a protein containing 63 aa, in which only the sequence of the first 58 aa is identical to wildtype socs3b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-181218-13 ihb320 Small Deletion embryos treated with CRISPR1-tnfrsf1a >WT AGATGCTGAAAGTTTGGAGTGATGGTGGCAGTGGAGGAGGGAACAATGTTGTGCCGTATGACCAAATCCAGA > ihb320 AGATGCTGAAAGTTTGGAGTGATGGTGGCAGGAGGGAACAATGTTGTGCCGTATGACCAAATCCAGA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-181218-14 ihb321 Small Deletion embryos treated with CRISPR1-ctsl.1 >WT CTGCCAGTCTTTCTCTGGAGGACATGGAGTTTCACGCCTGGAAACTGAAGTTTGGTAAGTCTAGC > ihb321 CTGCCAGTCTTTCTCTGGAGCCTGGAAACTGAAGTTTGGTAAGTCTAGC Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 17 2019-09-17
ZDB-ALT-181218-15 ihb322 Indel embryos treated with CRISPR1-ctsl.1 >WT CTGCCAGTCTTTCTCTGGAGGACATGGAGTTTCACGCCTGGAAACTGAAGTTTGGTAAGTCTAGC > ihb322 CTGCCAGTCTTTCTCTGGAGGACATGGAGTTTCATTGAAGTTTGGAAACTGAAGTTTGGTAAGTCTAGC Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 17 2019-09-17
ZDB-ALT-181218-16 ihb323 Insertion embryos treated with CRISPR1-stk33 >WT CATCGAGACGCAGAGGAAGTGGGCAATTAAGAAGGTGAACAAAGAGAAGGTAAGTGTTTGC > ihb323 CATCGAGACGCAGAGGAAGTGGGCAATTAGAAGAAGGTGAACAAAGAGAAGGTAAGTGTTTGC Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-181218-17 ihb324 Small Deletion embryos treated with CRISPR1-stk33 >WT CATCGAGACGCAGAGGAAGTGGGCAATTAAGAAGGTGAACAAAGAGAAGGTAAGTGTTTGC > ihb324 CATCGAGACGCAGAGGAAGTGGGCAATTAGGTGAACAAAGAGAAGGTAAGTGTTTGC Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-181218-18 ihb325 Small Deletion embryos treated with CRISPR4-smpx >WT CATCGAGACGCAGAGGAAGTGGGCAATTAAGAAGGTGAACAAAGAGAAGGTAAGTGTTTGC > ihb325 GGCCAACCTTAATATCCCGATGGGGGCTCTGCGTCCTGGGGACATCCTGTGAAGAGG Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-181218-19 ihb326 Indel embryos treated with CRISPR4-smpx >WT CATCGAGACGCAGAGGAAGTGGGCAATTAAGAAGGTGAACAAAGAGAAGGTAAGTGTTTGC > ihb326 GGCCAACCTTAATATCCCGATGGGGGCTCTTAATATCCCTTAATATCCCGAGCGGGACATCCTGTGAAGAGG Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-181226-1 ihb327Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(piwil1:EGFP-UTRnanos3) ZDB-TGCONSTRCT-181226-1 2019-09-17
ZDB-ALT-190111-4 ihb328 Indel embryos treated with CRISPR1-jag2b Between 2623bp to 2635 bp of the wild-type jag2b coding sequence, CTTCTGCCAGGGA, is mutated to TCGTGAAGCTCTCG in exon 23. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-190111-5 ihb329 Indel embryos treated with CRISPR2-jag2b Between 155bp to 159, the wild-type jag2b coding sequence, ACAGC,is mutated to GGGGAATGTTGCGACA in exon 2. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-140623-4 ihb33 Small Deletion embryos treated with TALEN1-socs1a Between the 313 bp and 315 bp of the wildtype socs1a coding sequence, a cytosine(C), is deleted. The mutated socs1a codes for a protein containing 63 aa, in which only the sequence of the first 22 aa is identical to wildtype socs1a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 3 2019-09-17
ZDB-ALT-190111-6 ihb330 Small Deletion embryos treated with CRISPR2-jag2b Between 159bp to 165 bp of the wild-type jag2b coding sequence, CACGCGG is deleted in exon 2 Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-190111-3 ihb331 Small Deletion embryos treated with CRISPR1-jag2b Between 2620bp to 2635 bp of the wild-type jag2b coding sequence, TGCCTTCTGCCAGGGA is deleted in exon 23. Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-190116-4 ihb332 Small Deletion embryos treated with CRISPR1-elovl2 The length of the deleted sequence is 20bp. The sequence of "TTACCGTCTTCAGTGTCAGG" which existed in exon4 of elovl2 gene from 27bp to 46bp was deleted Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-190116-5 ihb333 Small Deletion embryos treated with CRISPR1-elovl5 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-190123-672 ihb334 Insertion embryos treated with CRISPR3-npc1 Between 89 bp to 90 bp of the wild-type npc1 coding sequence, TG is inserted in exon 2. Hong Cao Lab ZDB-LAB-180404-1 Chr: 2 2019-09-17
ZDB-ALT-190123-674 ihb335 Small Deletion embryos treated with CRISPR3-npc1 Between 84 bp to 90 bp of the wild-type npc1 coding sequence, GTATCTG is deleted in exon 2 Hong Cao Lab ZDB-LAB-180404-1 Chr: 2 2019-09-17
ZDB-ALT-190405-2 ihb336 Small Deletion embryos treated with CRISPR1-ticam1 Between 222bp to 235 bp of the wild-type ticam1 coding sequence, CTACTTGGCGGAAA is deleted in exon2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 22 2019-09-17
ZDB-ALT-190405-3 ihb337 Insertion embryos treated with CRISPR1-ticam1 Between 229bp to 230 bp of the wild-type ticam1 coding sequence, GTTGG is inserted in exon2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 22 2019-09-17
ZDB-ALT-190405-4 ihb338 Small Deletion embryos treated with CRISPR1-mavs Between 118bp to 130 bp of the wild-type mavs coding sequence, CGGGTAAGTGGAT is deleted in exon3. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-190405-5 ihb339 Small Deletion embryos treated with CRISPR1-mavs Between 116bp to 120 bp of the wild-type mavs coding sequence, ATCGG is deleted in exon3. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 13 2019-09-17
ZDB-ALT-140623-5 ihb34 Small Deletion embryos treated with TALEN This mutant contains a deletion from bp31 to 41 of the wildtype socs2 coding sequence, AGCATCGAGAA, is deleted. The mutated socs2 codes for a protein containing 10 aa, and the sequence of the 10 aa is identical to wildtype socs2. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-190412-15 ihb340 Small Deletion embryos treated with CRISPR1-nsun2 2bp of “GG” deletion from position 68bp exon 3 of the wild-type nsun2 coding sequence. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 19 2019-09-17
ZDB-ALT-190412-16 ihb341 Indel embryos treated with CRISPR1-nsun2 3bp deletion, 14bp insertion. 67bp to 69 bp of the wild-type nsun2 exon 3 coding sequence, TGG, is mutated into ATAACAGGATACAA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 19 2019-09-17
ZDB-ALT-190423-6 ihb342 Small Deletion embryos treated with CRISPR1-slc12a10.2 Zhan Yin Lab ZDB-LAB-110330-2 Chr: 7 2019-09-17
ZDB-ALT-190426-5 ihb343 Small Deletion embryos treated with CRISPR1-slc12a3 Zhan Yin Lab ZDB-LAB-110330-2 Chr: 18 2019-09-17
ZDB-ALT-190520-2 ihb344 Indel embryos treated with CRISPR2-jag2b Yonghua Sun Lab ZDB-LAB-110721-1 Ambiguous 2019-09-17
ZDB-ALT-190522-2 ihb345 Small Deletion embryos treated with CRISPR1-apc Wild type TCTGATGGAGTGTGCCTTAGAGGTGCAGAAGgtaagatacatctctgattaattcagtaatcacaatcct >ihb345(-8bp) TCTGATGGAGTGTGCCTTAGAAGgtaagatacatctctgattaattcagtaatcacaatcct Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-190522-3 ihb346 Small Deletion embryos treated with CRISPR1-apc >Wild type TCTGATGGAGTGTGCCTTAGAGGTGCAGAAGgtaagatacatctctgattaattcagtaatcacaatcct >ihb346(-9bp，splice-site alterations) TCTGATGGAGTGTGCCTTAGAGGTaagatacatctctgattaattcagtaatcacaatcct Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-190524-2 ihb347 Small Deletion embryos treated with CRISPR2-apc >Wild type GTCCTGAGTGCCCTTTGGAACTTGTCGGCTCACTGCACTGAAAACAAA >ihb347(-5bp) GTCCTGAGTGCCCTTTGGAACGGCTCACTGCACTGAAAACAAA Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-190612-1 ihb348 Small Deletion embryos treated with TALEN3-lhb 16bp of "GACCACCATCTGCAGC" deletion from position 150bp exon2 of wild-type lhb coding sequence Zhan Yin Lab ZDB-LAB-110330-2 Chr: 13 2019-09-17
ZDB-ALT-190612-2 ihb349 Small Deletion embryos treated with TALEN3-lhb 8bp of "ATCTGCAG" deletion from position 157bp exon2 of wild-type lhb coding sequence Zhan Yin Lab ZDB-LAB-110330-2 Chr: 13 2019-09-17
ZDB-ALT-140623-6 ihb35 Small Deletion embryos treated with TALEN This mutant contains a deletion from bp277 to 283 of the wildtype socs3a coding sequence, CCAAGGT, is deleted. The mutated socs3a codes for a protein containing 62 aa, in which only the sequence of the first 31 aa is identical to wildtype socs3a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 3 2019-09-17
ZDB-ALT-190612-3 ihb350 Small Deletion embryos treated with TALEN1-star 1bp of "A" deletion at position 96bp exon2 of wild-type star coding sequence Zhan Yin Lab ZDB-LAB-110330-2 Chr: 8 2019-09-17
ZDB-ALT-190621-4 ihb351 Indel embryos treated with CRISPR1-fshb Zhan Yin Lab ZDB-LAB-110330-2 Chr: 7 2019-09-17
ZDB-ALT-190705-4 ihb352 Indel embryos treated with CRISPR2-il6 Between 194 bp to 196 bp of the wild-type il6 coding sequence, TGT, is mutated into G. The mutated il6 codes for a truncated protein containing 76 aa, 64 aa of which is identical to wildtype il6. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-190705-5 ihb353 Indel embryos treated with CRISPR2-il6 Between 193 bp to 204 bp of the wild-type il6 coding sequence, CTGTACAAGGAC, is mutated into GA. The mutated il6 codes for a truncated protein containing 65 aa, 64 aa of which is identical to wildtype il6. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-190705-7 ihb354 Insertion embryos treated with CRISPR1-tle3b A 119-bp fragment is inserted after "CAAGCTCAGTAC" Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-190705-8 ihb355 Small Deletion embryos treated with CRISPR1-tle3a Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-190705-9 ihb356 Insertion embryos treated with CRISPR1-tle3a, CRISPR1-tle3b "C" is inserted after "TCTAGCCCAGATT" Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-190705-10 ihb357 Indel embryos treated with TALEN Between 32bp to 34bp of the wild-type insra coding sequence, CGTCTGTCTACAC is mutanted to TTT in exon 1 Zhan Yin Lab ZDB-LAB-110330-2 Chr: 2 2019-09-17
ZDB-ALT-190705-11 ihb358 Small Deletion embryos treated with TALEN Between 26 bp to 35 bp of the wild-type insrb coding sequence, TTTTGGTCAC is deleted in exon 1. Zhan Yin Lab ZDB-LAB-110330-2 Chr: 22 2019-09-17
ZDB-ALT-190705-12 ihb359 Small Deletion embryos treated with CRISPR2-il6 193 bp to 212 bp of the wild-type il6 coding sequence, CTGTACAAGGACGTGAAGAC, is deleted. The mutated il6 codes for a truncated protein containing 70 aa, 64 aa of which is identical to wildtype il6. Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-140623-7 ihb36 Small Deletion embryos treated with TALEN This mutant contains a deletion from bp456 to 465 of the wildtype socs3b coding sequence, CAAACTGCAG, is deleted. The mutated socs3b codes for a protein containing 52 aa, in which only the sequence of the first 44 aa is identical to wildtype socs3b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-190731-1 ihb360 Small Deletion embryos treated with CRISPR1-nr6a1a Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-190830-8 ihb361 Small Deletion embryos treated with CRISPR2-amh 8bp deleted, 8bp of "AGGAGGGA" Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 22 2019-09-17
ZDB-ALT-190830-9 ihb362 Small Deletion embryos treated with CRISPR1-ints12 8bp deleted, 8bp of "GTGTGGTT" Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 1 2019-09-17
ZDB-ALT-190830-10 ihb363 Small Deletion 13bp deleted, 13bp of "GGTCTTGCTTGTG" Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 1 2019-09-17
ZDB-ALT-190830-11 ihb364 Small Deletion embryos treated with CRISPR1-hsd17b12a 8bp deleted, 8bp of "AACGGGGA" Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-190830-12 ihb365 Small Deletion embryos treated with CRISPR1-hsd17b12a 7bp deleted, 7bp of "GAGATCA" Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-190910-4 ihb366 Small Deletion embryos treated with CRISPR1-abcc4 Between 888 bp to 892 bp of the wild-type abcc4 coding sequence, CATGC , is deleted in exon 7. Cui Lab ZDB-LAB-131112-1 Unmapped 2019-09-17
ZDB-ALT-190910-5 ihb367Tg Transgenic Insertion embryos treated with DNA Cui Lab ZDB-LAB-131112-1 Unmapped Tg(Cca.Actb:abcc4-FLAG) ZDB-TGCONSTRCT-190910-3 2019-09-17
ZDB-ALT-141121-1 ihb37Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(kop:KALTA4-UTR-nanos1) ZDB-TGCONSTRCT-141117-2 2019-09-17
ZDB-ALT-141121-2 ihb38Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:zCas9-UTR-nanos1) ZDB-TGCONSTRCT-141121-1 2019-09-17
ZDB-ALT-141121-3 ihb39 Small Deletion embryos treated with CRISPR1-lbx2 193 bp to 199 bp of the wildtype lbx2 coding sequence, GGGTGCT, is deleted. The mutated lbx2 codes for a truncated protein containing 66 aa, 64 aa of which is identical to wildtype lbx2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 14 2019-09-17
ZDB-ALT-180523-1 ihb393 Small Deletion embryos treated with CRISPR1-stat5a Gui Lab ZDB-LAB-111031-1 Chr: 3 2019-09-17
ZDB-ALT-180523-2 ihb394 stat5.1 delta16 Small Deletion embryos treated with CRISPR1-stat5a Gui Lab ZDB-LAB-111031-1 Chr: 3 2019-09-17
ZDB-ALT-180523-3 ihb395 stat5.2 delta5 Small Deletion embryos treated with TALEN1-stat5b Gui Lab ZDB-LAB-111031-1 Ambiguous 2019-09-17
ZDB-ALT-180523-4 ihb396 stat5.1 delta 13 Small Deletion embryos treated with TALEN1-stat5b Gui Lab ZDB-LAB-111031-1 Ambiguous 2019-09-17
ZDB-ALT-180328-1 ihb397 Small Deletion embryos treated with CRISPR1-amh Gui Lab ZDB-LAB-111031-1 Chr: 22 2019-09-17
ZDB-ALT-180328-2 ihb398 Insertion embryos treated with CRISPR1-amh Gui Lab ZDB-LAB-111031-1 Chr: 22 2019-09-17
ZDB-ALT-180328-3 ihb399 Small Deletion embryos treated with CRISPR1-dmrt1 Gui Lab ZDB-LAB-111031-1 Chr: 5 2019-09-17
ZDB-ALT-080214-4 ihb3Tg Tg(CMV:lox71-EGFP)ihb3, Tg(CMV:lox71-EGFP)zf76, zf76 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(CMV:lox71-EGFP) ZDB-TGCONSTRCT-080214-3 2019-09-17
ZDB-ALT-141121-4 ihb40 Small Deletion embryos treated with CRISPR1-lbx2 176 bp to 192 bp of the wildtype lbx2 coding sequence, GTTTGTGCCCTCCGCGG, is deleted. The mutated lbx2 codes for a truncated protein containing 91 aa, 58 aa of which is identical to wildtype lbx2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 14 2019-09-17
ZDB-ALT-180328-4 ihb400 Indel embryos treated with CRISPR1-dmrt1 Gui Lab ZDB-LAB-111031-1 Chr: 5 2019-09-17
ZDB-ALT-160408-4 ihb401Tg Transgenic Insertion embryos treated with DNA Gui Lab ZDB-LAB-111031-1 Unmapped Tg(dmrta2:RTTA,CMV:MYC-dmrta2_R106Q) ZDB-TGCONSTRCT-160408-4 2019-09-17
ZDB-ALT-160408-5 ihb402Tg Transgenic Insertion embryos treated with DNA Gui Lab ZDB-LAB-111031-1 Unmapped TgBAC(cdkn2c:EGFP) ZDB-TGCONSTRCT-160408-10 2019-09-17
ZDB-ALT-160408-6 ihb403Tg Transgenic Insertion embryos treated with DNA Gui Lab ZDB-LAB-111031-1 Unmapped TgBAC2(cdkn2c:EGFP) ZDB-TGCONSTRCT-160408-11 2019-09-17
ZDB-ALT-170405-1 ihb404 Insertion embryos treated with CRISPR1-foxo3b Xiao Lab ZDB-LAB-101011-1 Chr: 20 2019-09-17
ZDB-ALT-150115-2 ihb41 Insertion embryos treated with CRISPR1-ca15b Between 255 bp and 256 bp of the wild-type ca15b coding sequence, a “C” is inserted. The mutated ca15b codes for a truncated protein containing 90 aa, 85 aa of which are identical to wild-type ca15b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-150115-3 ihb42 Small Deletion embryos treated with CRISPR1-ca15b Between 255 bp to 261 bp of the wild-type ca15b coding sequence, GCGTGTG, is deleted. The mutated ca15b codes for a truncated protein containing 127 aa, 84 aa of which is identical to wild-type ca15b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-150414-4 ihb43Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(kop:LOXP-SV40-LOXP-bbc3-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-150414-4 2019-09-17
ZDB-ALT-150423-1 ihb44 Insertion embryos treated with CRISPR1-nod1 590 bp to 595 bp of the wildtype nod1 coding sequence, TCATCA, is inserted into GATGACGC. The mutated nod1 codes for a truncated protein containing 196 aa, all of which is identical to wildtype nod1. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-150423-3 ihb45 Insertion embryos treated with CRISPR1-ripk2 Between 103 bp and 104 bp of the wildtype ripk2 coding sequence, a “A” is inserted. The mutated ripk2 codes for a truncated protein containing 48 aa, 34 aa of which is identical to wildtype ripk2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-150423-4 ihb46 Indel embryos treated with CRISPR1-ripk2 Between 73 bp and 74 bp of the wildtype ripk2 coding sequence, ACCGGTGATCCCGT, is inserted, while 93 bp to 103 bp of the wildtype ripk2 coding sequence, GCACTACATCA, is deleted. The mutated ripk2 codes for a truncated protein containing 32 aa, 24 aa of which is identical to wildtype ripk2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-150423-5 ihb47 Indel embryos treated with CRISPR1-ripk2 102 bp to 103 bp of the wildtype ripk2 coding sequence, CA, is mutated into T. The mutated ripk2 codes for a truncated protein containing 58 aa, 33 aa of which is identical to wildtype ripk2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 2 2019-09-17
ZDB-ALT-150115-4 ihb48 Small Deletion embryos treated with CRISPR1-nlrc5 G85 of the wildtype nlcr5 coding sequence is deleted. The mutated nlrc5 codes for a truncated protein containing 52 aa, 28 aa of which is identical to wildtype nlrc5. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-150423-6 ihb49 Indel embryos treated with CRISPR1-nlrc5 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-180927-4 ihb493 Insertion embryos treated with CRISPR1-slbp2 Gui Lab ZDB-LAB-111031-1 Chr: 21 2019-09-17
ZDB-ALT-180927-5 ihb494 Small Deletion embryos treated with CRISPR1-slbp Gui Lab ZDB-LAB-111031-1 Chr: 14 2019-09-17
ZDB-ALT-180927-6 ihb495 Small Deletion embryos treated with TALEN1-pclaf,cntn1a Gui Lab ZDB-LAB-111031-1 Chr: 25 2019-09-17
ZDB-ALT-180927-7 ihb496 Small Deletion embryos treated with TALEN1-pclaf,cntn1a Gui Lab ZDB-LAB-111031-1 Chr: 25 2019-09-17
ZDB-ALT-110825-1 ihb4Tg Tg(-1.9mylpfa:fsta,krt8:EGFP)ihb4 Transgenic Insertion embryos treated with DNA Zhan Yin Lab ZDB-LAB-110330-2 Unmapped Tg(-1.9mylpfa:fsta,krt8:EGFP) ZDB-TGCONSTRCT-110825-1 2019-09-17
ZDB-ALT-170215-6 ihb504 Small Deletion embryos treated with CRISPR1-akt2 Xiao Lab ZDB-LAB-101011-1 Chr: 18 2019-09-17
ZDB-ALT-170215-7 ihb505 Insertion embryos treated with CRISPR1-akt2 Xiao Lab ZDB-LAB-101011-1 Chr: 18 2019-09-17
ZDB-ALT-180803-1 ihb506 Small Deletion embryos treated with TALEN1-kmt2a the 4bp sequence GAAA was deleted in exon1 Xiao Lab ZDB-LAB-101011-1 Chr: 15 2019-09-17
ZDB-ALT-180803-2 ihb507 Small Deletion embryos treated with CRISPR1-kmt2a the 29bp CCCAACCATCCTACCAGACCCACCAAGAA sequence was deleted in exon5 Xiao Lab ZDB-LAB-101011-1 Chr: 15 2019-09-17
ZDB-ALT-180808-2 ihb508 Small Deletion embryos treated with CRISPR1-ell Xiao Lab ZDB-LAB-101011-1 Chr: 22 2019-09-17
ZDB-ALT-141007-2 ihb50Tg Transgenic Insertion embryos treated with DNA Gui Lab ZDB-LAB-111031-1 Unmapped Tg(Eco.Tshb:EGFP) ZDB-TGCONSTRCT-141007-2 2019-09-17
ZDB-ALT-150423-7 ihb51 Insertion embryos treated with CRISPR1-nlrc5 Between 85 bp and 86 bp of the wildtype nlcr5 coding sequence, AGTA, is inserted. The mutated nlrc5 codes for a truncated protein containing 29 aa, 28 aa of which is identical to wildtype nlrc5. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 18 2019-09-17
ZDB-ALT-150424-1 ihb52 Insertion embryos treated with CRISPR1-nod1 Between 591 bp and 592 bp of the wildtype nod1 coding sequence, a “A” is inserted. The mutated nod1 codes for a truncated protein containing 200 aa, 197 aa of which is identical to wildtype nod1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 16 2019-09-17
ZDB-ALT-150928-7 ihb53 Small Deletion embryos treated with CRISPR1-cadm1a Between 149 bp to 152 bp of the wild-type cadm1a coding sequence, TG, is deleted. The mutated cadm1a codes for a truncated protein containing 63 aa, of which 49 aa are identical to wildtype cadm1a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-150928-8 ihb54 Small Deletion embryos treated with CRISPR1-cadm1a Between 150 bp to 155 bp of the wild-type cadm1a coding sequence, GGAA, is deleted. The mutated cadm1a codes for a truncated protein containing 55 aa, of which 49 aa are identical to wildtype cadm1a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-150928-9 ihb55 Indel embryos treated with CRISPR1-cadm1a 149 bp to 151 bp of the wildtype cadm1a coding sequence, TGG, is mutated into ACAGCCTACT. The mutated cadm1a codes for a truncated protein containing 66 aa, of which 49 aa are identical to wildtype cadm1a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-150929-1 ihb56 Small Deletion embryos treated with CRISPR1-fundc2 Between 136 bp to 144 bp of the wild-type fundc2 coding sequence, TGGCCAT, is deleted. The mutated fundc2 codes for a truncated protein containing 48 aa, 45 aa of which is identical to wildtype fundc2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-150929-2 ihb57 ihb57Tg Small Deletion embryos treated with CRISPR1-fundc2 Between 117 bp to 144 bp of the wild-type fundc2 coding sequence, TACTCTGTGGCCACACAGCTGGCCAT, is deleted. The mutated fundc2 codes for a truncated protein containing 78 aa, 39 aa of which is identical to wildtype fundc2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-150929-3 ihb58 ihb58Tg Indel embryos treated with CRISPR1-fundc2 140 bp to 146 bp of the wild-type fundc2 coding sequence, CATTG, is mutated into GAGT. The mutated fundc2 codes for a truncated protein containing 50 aa, 46 aa of which are identical to wildtype fundc2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-150930-2 ihb59 Small Deletion embryos treated with CRISPR1-pclaf Between 313 bp to 331 bp of the wild-type KIAA0101 coding sequence, GATCCTCGAACGCGCAG, is deleted. The mutated KIAA0101 codes for a truncated protein containing 114 aa, 104 aa of which are identical to wildtype KIAA0101. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-120719-1 ihb5Tg Tg(-2.5tshb:EGFP)ihb5 Transgenic Insertion embryos treated with DNA Zhan Yin Lab ZDB-LAB-110330-2 Unmapped Tg(-2.5tshb:EGFP) ZDB-TGCONSTRCT-120719-1 2019-09-17
ZDB-ALT-150930-3 ihb60 Small Deletion embryos treated with CRISPR1-pclaf Between 328 bp to 348 bp of the wild-type KIAA0101 coding sequence, AGAGCGGCAGCGCGCAGTC, is deleted. The mutated KIAA0101 codes for a prolonged protein containing 302 aa, 109 aa of which are identical to wildtype KIAA0101. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 25 2019-09-17
ZDB-ALT-190318-1 ihb601 -7 +2 scg2a Indel embryos treated with TALEN1-scg2a Wei Hu lab ZDB-LAB-110815-1 Chr: 15 2019-09-17
ZDB-ALT-190318-2 ihb602 -7 scg2a Small Deletion embryos treated with TALEN1-scg2a Wei Hu lab ZDB-LAB-110815-1 Chr: 15 2019-09-17
ZDB-ALT-190318-3 ihb603 -5 +7 scg2b Indel embryos treated with TALEN1-scg2b Wei Hu lab ZDB-LAB-110815-1 Chr: 2 2019-09-17
ZDB-ALT-190318-4 ihb604 -10 scg2b Small Deletion embryos treated with TALEN1-scg2b Wei Hu lab ZDB-LAB-110815-1 Chr: 2 2019-09-17
ZDB-ALT-151023-1 ihb61 Small Deletion embryos treated with CRISPR1-lhx2b Between 240 bp to 258 bp of the wild-type lhx2b coding sequence, GTGGCTCTGTGCGCCGG, is deleted. The mutated lhx2b codes for a truncated protein containing 108 aa, 80 aa of which are identical to wildtype lhx2b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 8 2019-09-17
ZDB-ALT-151023-2 ihb62 Small Deletion embryos treated with CRISPR1-lhx2b Between 247 bp to 252 bp of the wild-type lhx2b coding sequence, TGTG, is deleted. The mutated lhx2b codes for a truncated protein containing 107 aa, 82 aa of which are identical to wildtype lhx2b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 8 2019-09-17
ZDB-ALT-151023-3 ihb63 Indel embryos treated with CRISPR1-lhx2b Between 251 bp and 253 bp of the wildtype lhx2b coding sequence, C, is mutated into GAGGCT. The mutated lhx2b codes for a truncated protein containing 110 aa, 83 aa of which are identical to wildtype lhx2b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 8 2019-09-17
ZDB-ALT-151023-4 ihb64 Insertion embryos treated with CRISPR2-slc45a2 Between 503 bp and 504 bp of the wild-type slc45a2 coding sequence, T, is inserted. The mutated slc45a2 codes for a truncated protein containing 174 aa, 167 aa of which are identical to wildtype slc45a2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-151023-5 ihb65 Small Deletion embryos treated with CRISPR2-slc45a2 Between 491 bp and 506 bp of the wild-type slc45a2 coding sequence, CGTGGTGGTGATGT, is deleted. The mutated slc45a2 codes for a truncated protein containing 169 aa, 163 aa of which are identical to wildtype slc45a2. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-180517-4 ihb651 Insertion embryos treated with CRISPR6-rela Xiao Lab ZDB-LAB-101011-1 Chr: 7 2019-09-17
ZDB-ALT-180517-5 ihb652 Small Deletion embryos treated with CRISPR6-rela Xiao Lab ZDB-LAB-101011-1 Chr: 7 2019-09-17
ZDB-ALT-151023-6 ihb66 Small Deletion embryos treated with CRISPR2-slc45a2 Between 496 bp and 510 bp of the wild-type slc45a2 coding sequence, TGGTGATGTTTGG, is deleted. The mutated slc45a2 codes for a truncated protein containing 213 aa, 165 aa of which are identical to wildtype slc45a2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-151023-7 ihb67 Indel embryos treated with CRISPR1-akap12b Between 105 bp and 108 bp of the wild-type akap12b coding sequence, AT, is mutated into TGGAGA. The mutated akap12b codes for a truncated protein containing 49 aa, 35 aa of which are identical to wildtype akap12b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-151023-8 ihb68 Small Deletion embryos treated with CRISPR1-akap12b Between 108 bp and 113 bp of the wild-type akap12b coding sequence, AATG, is deleted. The mutated akap12b codes for a truncated protein containing 56 aa, 36 aa of which are identical to wildtype akap12b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-151023-9 ihb69 Small Deletion embryos treated with CRISPR1-akap12b Between 95 bp and 107 bp of the wild-type akap12b coding sequence, TGCCCCTCAAA, is deleted. The mutated akap12b codes for a truncated protein containing 44 aa, 31 aa of which are identical to wildtype akap12b. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 20 2019-09-17
ZDB-ALT-121211-1 ihb6Tg Tg(zp3:fsta,myl7:EGFP)ihb6 Transgenic Insertion embryos treated with DNA Zhan Yin Lab ZDB-LAB-110330-2 Unmapped Tg(zp3:fsta,myl7:EGFP) ZDB-TGCONSTRCT-121211-1 2019-09-17
ZDB-ALT-151116-1 ihb70 Indel embryos treated with CRISPR Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 23 2019-09-17
ZDB-ALT-151116-2 ihb71Tg pTol2(CMV:fundc2-SV40) Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(CMV:fundc2-SV40) ZDB-TGCONSTRCT-151116-1 2019-09-17
ZDB-ALT-151201-3 ihb72 Indel embryos treated with CRISPR1-cpamd8 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 22 2019-09-17
ZDB-ALT-151214-9 ihb73 Insertion embryos treated with CRISPR1-pde6c Between 568 bp to 569 bp of the wild-type pde6c coding sequence, CA, is inserted. The mutated pde6c codes for a truncated protein containing 193 aa, 189 aa of which are identical to wildtype pde6c. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-151214-10 ihb74 Insertion embryos treated with CRISPR1-pde6c Between 566 bp to 567 bp of the wild-type pde6c coding sequence, GGCAATAAACAATAAACAAACAATAAACAATAAACAATAAACAATAAACAA, is inserted. The mutated pde6c codes for a truncated protein containing 201 aa, 188 aa of which are identical to wildtype pde6c Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-151214-11 ihb75 Insertion embryos treated with CRISPR1-pde6c Between 568 bp to 569 bp of the wild-type pde6c coding sequence, CAATCAA, is inserted. The mutated pde6c codes for a truncated protein containing 207 aa, 189 aa of which are identical to wildtype pde6c Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-151215-7 ihb76 Indel embryos treated with CRISPR1-rusc2 Between 874 bp to 877 bp of the wild-type rusc2 coding sequence, TGGA, is mutated into ACCAAGTT. The mutated rusc2 codes for a truncated protein containing 296 aa, 291 aa of which are identical to wildtype rusc2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-151215-8 ihb77 Small Deletion embryos treated with CRISPR1-rusc2 Between 877 bp to 888 bp of the wild-type rusc2 coding sequence, GTGTGGTTGA, is deleted. The mutated rusc2 codes for a truncated protein containing 311 aa, 292 aa of which are identical to wildtype rusc2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-151215-9 ihb78 Insertion embryos treated with CRISPR1-rusc2 Between 877 bp to 878 bp of the wild-type rusc2 coding sequence, T, is inserted. The mutated rusc2 codes for a truncated protein containing 295 aa, 292 aa of which are identical to wildtype rusc2 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 5 2019-09-17
ZDB-ALT-151217-2 ihb79Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(mylpfa:KALTA4,4xUAS:EGFP) ZDB-TGCONSTRCT-151217-2 2019-09-17
ZDB-ALT-130128-5 ihb7Tg Tg(kop:Cre-UTRnanos3,CMV:EGFP)ihb7 Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(kop:Cre-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-130128-3 2019-09-17
ZDB-ALT-151217-3 ihb80Tg Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(tpma:KALTA4,4xUAS:EGFP) ZDB-TGCONSTRCT-151217-3 2019-09-17
ZDB-ALT-151218-11 ihb81 Indel embryos treated with CRISPR1-irf1b mutation sequence: CCTGGCTGGAGAGCAGGATCGACTCCAACACCATCAATGGACTCATTACAAGGTAAAGCCGAGCGCTGCACA in exon 1 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-171206-3 ihb815 Small Deletion embryos treated with CRISPR1-bloc1s1 Homozygotes die between 7 and 15 dpf.; The bloc1s1 ihb815 allele harbors a 17-bp deletion that includes the splicing donor (SD) site between exon 2 and intron 2, resulting in a new splicing donor site within intron 2 and formation of a chimeric transcript. There is a frameshift after the CRISPR/Cas9 target site, and the presumptive proteins were truncated. The relative mRNA expression level was also significantly reduced in homozygotes, likely through a nonsense-mediated decay mechanism. Cui Lab ZDB-LAB-131112-1 Chr: 22 2019-09-17
ZDB-ALT-171206-4 ihb816 Small Deletion embryos treated with CRISPR1-bloc1s1 Homozygotes die between 7 and 15 dpf.; Larvae show same phenotypes as ihb815. Cui Lab ZDB-LAB-131112-1 Chr: 22 2019-09-17
ZDB-ALT-171206-5 ihb817 Small Deletion embryos treated with CRISPR1-tfeb Cui Lab ZDB-LAB-131112-1 Chr: 11 2019-09-17
ZDB-ALT-171212-1 ihb818 Small Deletion embryos treated with CRISPR2-bloc1s2 homozygotes can survive to adulthood, although with poor growth and low survival rates Cui Lab ZDB-LAB-131112-1 Chr: 20 2019-09-17
ZDB-ALT-171212-2 ihb819 Small Deletion embryos treated with CRISPR1-dtnbp1a homozygotes can survive to adulthood, although with poor growth and low survival rates Cui Lab ZDB-LAB-131112-1 Chr: 16 2019-09-17
ZDB-ALT-151218-2 ihb82 Small Deletion embryos treated with CRISPR Between 216 bp to 224 bp of the wild-type trim47 coding sequence, GATGTGG, is deleted. The mutated trim47 codes for a truncated protein containing 195 aa, of which 479 aa are identical to wildtype trim47.\n Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-151218-10 ihb83 Small Deletion embryos treated with CRISPR Between 643 bp to 651 bp of the wild-type namptb coding sequence, ACCGTGG, is deleted. The mutated namptb codes for a truncated protein containing 495 aa, of which 498 aa are identical to wildtype namptb.\n Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 11 2019-09-17
ZDB-ALT-151218-12 ihb84 Insertion embryos treated with CRISPR1-cpamd8 Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 22 2019-09-17
ZDB-ALT-151218-13 ihb85 Insertion Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 21 2019-09-17
ZDB-ALT-160111-1 ihb86 Small Deletion embryos treated with CRISPR Between 215 bp to 221 bp of the wild-type trim47 coding sequence, TGATG, is deleted. The mutated trim47 codes for a truncated protein containing 78 aa, of which 479 aa are identical to wildtype trim47. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 10 2019-09-17
ZDB-ALT-160111-2 ihb87 Insertion embryos treated with CRISPR1-nhsa Between 1302 bp to 1303 bp of the wild-type nhsa coding sequence, GAGTCAT, is inserted. The mutated nhsa codes for a truncated protein containing 436 aa, 434 aa of which are identical to wildtype nhsa Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 23 2019-09-17
ZDB-ALT-160111-3 ihb88 Small Deletion embryos treated with CRISPR1-nhsa Between 1303 bp to 1306 bp of the wild-type nhsa coding sequence, GATG, is deleted. The mutated nhsa codes for a truncated protein containing 465 aa, 434 aa of which are identical to wildtype nhsa. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 23 2019-09-17
ZDB-ALT-160111-4 ihb89 Insertion embryos treated with CRISPR1-nhsa Between 1304 bp to 1305 bp of the wild-type nhsa coding sequence, CTGGTGACTGG, is inserted. The mutated nhsa codes for a truncated protein containing 436 aa, 434 aa of which are identical to wildtype nhsa. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 23 2019-09-17
ZDB-ALT-130128-6 ihb8Tg Tg(kop:KalTA4-UTRnanos3,CMV:EGFP)ihb8, Tg(kop:KalTA4-UTRnos1,CMV:EGFP) Transgenic Insertion embryos treated with DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(kop:KALTA4-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-130128-4 2019-09-17
ZDB-ALT-160111-5 ihb90 Small Deletion embryos treated with CRISPR2-nlgn2a 627 bp to 636 bp of the wild-type nlgn2a coding sequence, CTATGGGAAC, is deleted. The mutated nlgn2a codes for a truncated protein containing 211 aa, 208 aa of which is identical to wildtype nlgn2a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-160111-6 ihb91 Insertion embryos treated with CRISPR2-nlgn2a Between 631 bp to 632 bp of the wild-type nlgn2a coding sequence, CAGCCTATGCAGCCTA, is inserted. The mutated nlgn2a codes for a truncated protein containing 216 aa, 210 aa of which are identical to wildtype nlgn2a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-160111-7 ihb92 Small Deletion embryos treated with CRISPR2-nlgn2a 632 bp to 633 bp of the wild-type nlgn2a coding sequence, GG, is deleted. The mutated nlgn2a codes for a truncated protein containing 227 aa, 210 aa of which are identical to wildtype nlgn2a Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 7 2019-09-17
ZDB-ALT-160111-8 ihb93 Indel embryos treated with CRISPR 644 bp to 651 bp of the wildtype namptb coding sequence, TGG, is mutated into ACAGCCTACT. The mutated namptb codes for a truncated protein containing 266 aa, of which 498 aa are identical to wildtype namptb.\n Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 11 2019-09-17
ZDB-ALT-160119-1 ihb94 Small Deletion embryos treated with CRISPR1-ndel1a Eight nucleotides, AACCACAG, located in the splice acceptor site of intron 4, are deleted. This mutation may lead to mis-splicing of the ndel1a transcript, resulting in the use of an alternative acceptor site (changing the 5’ boundary of the downstream exon 5) or simply the retention of the intron 4. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-160119-2 ihb95 Indel embryos treated with CRISPR1-ndel1a Three nucleotides, CAG, located in the splice acceptor site of intron 4, are deleted. Plus the adjacent twenty-nine-nucleotide coding sequence, AGCCACCATAACATCTCTGGAGGACTTTG, is mutated into GAGGCTGAGCAGAGGCTGA. This mutation may lead to mis-splicing of the ndel1a transcript, resulting in the use of an alternative acceptor site (changing the 5’ boundary of the downstream exon 5) or simply the retention of the intron 4. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-160119-3 ihb96 Small Deletion embryos treated with CRISPR1-ndel1a 390 bp to 396 bp of the wild-type ndel1a coding sequence, AGCCACC, is deleted. The mutated ndel1a codes for a truncated protein containing 130 aa, 129 aa of which are identical to wildtype ndel1a. Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 12 2019-09-17
ZDB-ALT-160128-1 ihb97 Small Deletion embryos treated with TALEN Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-160128-2 ihb98 Insertion embryos treated with TALEN Yonghua Sun Lab ZDB-LAB-110721-1 Chr: 24 2019-09-17
ZDB-ALT-190705-6 ihb99 Indel embryos treated with CRISPR1-eef1a1b,eef1a1l2 Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped 2019-09-17
ZDB-ALT-130128-7 ihb9Tg Tg(UAS:mRFP-UTRnanos3,CMV:EGFP)ihb9, Tg(UAS:mRFP-UTRnos1,CMV:EGFP) Transgenic Insertion DNA Yonghua Sun Lab ZDB-LAB-110721-1 Unmapped Tg(UAS:mRFP-UTR-nanos3,CMV:EGFP) ZDB-TGCONSTRCT-130128-2 2019-09-17
ZDB-ALT-190405-1 ihbp3 Insertion embryos treated with CRISPR Xiao Lab ZDB-LAB-101011-1 Chr: 17 2019-09-17
ZDB-ALT-190102-2 ihbp3d20 Small Deletion embryos treated with CRISPR1-prmt3 Xiao Lab ZDB-LAB-101011-1 Chr: 7 2019-09-17
ZDB-ALT-190102-3 ihbp3i7 Insertion embryos treated with CRISPR1-prmt3 Xiao Lab ZDB-LAB-101011-1 Chr: 7 2019-09-17
ZDB-ALT-181217-11 ihbp4 Small Deletion embryos treated with CRISPR1-prmt7 Xiao Lab ZDB-LAB-101011-1 Chr: 25 2019-09-17
ZDB-ALT-181107-9 ihbp7 Small Deletion embryos treated with CRISPR1-prmt7 Xiao Lab ZDB-LAB-101011-1 Chr: 25 2019-09-17
ZDB-ALT-190724-2 ihby1 Insertion embryos treated with CRISPR3-setd7 insert 2bp in exon1 Xiao Lab ZDB-LAB-101011-1 Unmapped 2019-09-17
ZDB-ALT-190724-3 ihbyp3 Insertion embryos treated with CRISPR1-egln3 insert 1bp in exon 1 Xiao Lab ZDB-LAB-101011-1 Unmapped 2019-09-17
ZDB-ALT-161104-1 ii001 Small Deletion embryos treated with TALEN1-mapkbp1 p.P911fs20* Saunier's lab ZDB-LAB-160309-1 Chr: 17 2019-09-17
ZDB-ALT-180611-4 iim010Tg Transgenic Insertion Rotllant Lab ZDB-LAB-140206-1 Unmapped Tg(Xla.Eef1a1:pth4) ZDB-TGCONSTRCT-180611-5 2019-09-17
ZDB-ALT-180608-3 iim014Tg Transgenic Insertion embryos treated with DNA Rotllant Lab ZDB-LAB-140206-1 Unmapped TgBAC(asip1:EGFP) ZDB-TGCONSTRCT-180608-1 2019-09-17
ZDB-ALT-180611-2 iim015Tg Transgenic Insertion Rotllant Lab ZDB-LAB-140206-1 Unmapped TgBAC(Loc.Asip1:EGFP) ZDB-TGCONSTRCT-180611-3 2019-09-17
ZDB-ALT-190726-1 iim016 iim07 Small Deletion embryos treated with CRISPR1-asip1 Rotllant Lab ZDB-LAB-140206-1 Chr: 6 2019-09-17
ZDB-ALT-180417-6 iim01Tg Transgenic Insertion embryos treated with DNA Rotllant Lab ZDB-LAB-140206-1 Unmapped Tg(-0.8mustn1b:EGFP) ZDB-TGCONSTRCT-180417-4 2019-09-17
ZDB-ALT-190725-7 iim02 Small Deletion embryos treated with CRISPR1-asip1 Rotllant Lab ZDB-LAB-140206-1 Chr: 6 2019-09-17
ZDB-ALT-161010-13 iim03Tg Transgenic Insertion embryos treated with DNA Rotllant Lab ZDB-LAB-140206-1 Unmapped Tg(Xla.Eef1a1:Cau.Asip1) ZDB-TGCONSTRCT-160818-1 2019-09-17
ZDB-ALT-160818-2 iim04Tg Transgenic Insertion embryos treated with DNA Rotllant Lab ZDB-LAB-140206-1 Unmapped Tg(Xla.Eef1a1:Cau.Asip1) ZDB-TGCONSTRCT-160818-1 2019-09-17
ZDB-ALT-161010-14 iim05Tg Transgenic Insertion embryos treated with DNA Rotllant Lab ZDB-LAB-140206-1 Unmapped Tg(Xla.Eef1a1:Cau.Asip1) ZDB-TGCONSTRCT-160818-1 2019-09-17
ZDB-ALT-180611-3 iim07Tg Transgenic Insertion embryos treated with DNA P2 line from Suarez-Bregua, et al. (2017) Rotllant Lab ZDB-LAB-140206-1 Unmapped Tg(pth4:EGFP) ZDB-TGCONSTRCT-180611-4 2019-09-17
ZDB-ALT-190725-8 iim08 Indel embryos treated with CRISPR1-asip1 Rotllant Lab ZDB-LAB-140206-1 Chr: 6 2019-09-17
ZDB-ALT-160707-14 imb1 max Small Deletion embryos treated with TALEN2-aplnra Human Embryology ZDB-LAB-110330-1 Chr: 8 2019-09-17
ZDB-ALT-161103-2 imb2 10.1 Small Deletion embryos treated with CRISPR1-elmo2 Results in C-terminal truncated protein, p.Ser326ArgfsTer21. Human Embryology ZDB-LAB-110330-1 Chr: 11 2019-09-17
ZDB-ALT-161103-3 imb3 10.2 Small Deletion embryos treated with CRISPR1-elmo2 Results in C-terminal truncated protein, p.Ser326ArgfsTer21. Human Embryology ZDB-LAB-110330-1 Chr: 11 2019-09-17
ZDB-ALT-161103-4 imb4 21 Small Deletion embryos treated with CRISPR1-elmo2 Mutation results in p.Asp321_Gly327del and is predicted to be missing seven amino acids from the ELMO domain. Human Embryology ZDB-LAB-110330-1 Chr: 11 2019-09-17
ZDB-ALT-130502-2 imm001Tg Tg(hsp70l:HA-msgn1,Xla.Cryg:ECFP)imm001 Transgenic Insertion embryos treated with DNA Leonor Saude Lab ZDB-LAB-070619-2 Unmapped Tg(hsp70l:HA-msgn1,Xla.Cryg:ECFP) ZDB-TGCONSTRCT-130502-1 2019-09-17
ZDB-ALT-181115-2 imm002Tg Transgenic Insertion embryos treated with DNA Leonor Saude Lab ZDB-LAB-070619-2 Unmapped Tg(hsp70l:HA-dmrt2a,Xla.Cryaa:CFP) ZDB-TGCONSTRCT-181115-1 2019-09-17
ZDB-ALT-181115-3 imm003 Small Deletion embryos treated with TALEN1-dmrt2a, TALEN2-dmrt2a This allele lacks the 3’end of the 5’UTR, the start codon and part of the first exon. One ATG located near the 3’end of the DM domain might be used, which would results in the truncation of the DM domain and consequently, the loss of the residues shown to be crucial for nuclear translocation. Leonor Saude Lab ZDB-LAB-070619-2 Chr: 5 2019-09-17
ZDB-ALT-181115-4 imm004 Complex embryos treated with TALEN1-dmrt2a, TALEN2-dmrt2a One ATG located near the 3’end of the DM domain might be used, which would results in the truncation of the DM domain and consequently, the loss of the residues shown to be crucial for nuclear translocation.; There are two mutations present in this line, the first is an indel and the second is an insertion. Leonor Saude Lab ZDB-LAB-070619-2 Chr: 5 2019-09-17
ZDB-ALT-181115-5 imm005 Insertion embryos treated with TALEN1-dmrt2b Leonor Saude Lab ZDB-LAB-070619-2 Chr: 6 2019-09-17
ZDB-ALT-130711-1 in1Tg Tg(Xla.Eef1a1:h2b-mRFP1)in1 Transgenic Insertion embryos treated with DNA Nieto Lab ZDB-LAB-110912-2 Unmapped Tg(Xla.Eef1a1:h2b-mRFP1) ZDB-TGCONSTRCT-130711-1 2019-09-17
ZDB-ALT-171103-4 in2Tg Transgenic Insertion embryos treated with DNA Nieto Lab ZDB-LAB-110912-2 Unmapped TgBAC(tbx5a:EGFP) ZDB-TGCONSTRCT-171103-3 2019-09-17
ZDB-ALT-101008-7 inka1a_unrecovered fam212aa_unrecovered, inka1a_unrecovered, unrec_inka1a, unrecovered_inka1a Point Mutation adult males treated with ENU Chr: 11 2019-09-17
ZDB-ALT-130910-1 inr1Tg C2, Tg(gsdf:EGFP)inr1 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(gsdf:EGFP) ZDB-TGCONSTRCT-130910-1 2019-09-17
ZDB-ALT-130910-2 inr2Tg C5, Tg(gsdf:EGFP)inr2 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(gsdf:EGFP) ZDB-TGCONSTRCT-130910-1 2019-09-17
ZDB-ALT-130703-1 inr3Tg Line 1, Tg(CMV:EGFP)inr3 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(CMV:EGFP) ZDB-TGCONSTRCT-130703-1 2019-09-17
ZDB-ALT-130703-2 inr4Tg Line 2, Tg(CMV:EGFP)inr4 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(CMV:EGFP) ZDB-TGCONSTRCT-130703-1 2019-09-17
ZDB-ALT-130703-3 inr5Tg Line 3, Tg(CMV:EGFP)inr5 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(CMV:EGFP) ZDB-TGCONSTRCT-130703-1 2019-09-17
ZDB-ALT-130919-3 inr6Tg C2, Tg(sycp1:GFP)inr6 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(sycp1:GFP) ZDB-TGCONSTRCT-130919-3 2019-09-17
ZDB-ALT-130919-4 inr7Tg C3, Tg(sycp1:GFP)inr7 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(sycp1:GFP) ZDB-TGCONSTRCT-130919-3 2019-09-17
ZDB-ALT-130919-5 inr8Tg C5, Tg(sycp1:GFP)inr8 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(sycp1:GFP) ZDB-TGCONSTRCT-130919-3 2019-09-17
ZDB-ALT-130919-6 inr9Tg C7, Tg(sycp1:GFP)inr9 Transgenic Insertion embryos treated with DNA Institut National de la Recherche Agronomique, Laboratoire de Physiologie et Génomique des Poissons ZDB-LAB-130702-1 Unmapped Tg(sycp1:GFP) ZDB-TGCONSTRCT-130919-3 2019-09-17
ZDB-ALT-111010-6 intu_unrecovered Point Mutation adult males treated with ENU Chr: 7 2019-09-17
ZDB-ALT-081007-2 io004Tg Tg(tbr1:EYFP)io004 Transgenic Insertion embryos treated with DNA This line was created with the same construct as in Tg(tbr1:EYFP)jt003, but has a different insertion. Mione Lab ZDB-LAB-050531-2 Unmapped Tg(tbr1:EYFP) ZDB-TGCONSTRCT-070117-115 2019-09-17
ZDB-ALT-081006-3 io005Tg Tg(Xleomes:GFP)io005 Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Tg(Xla.Eomes:GFP) ZDB-TGCONSTRCT-081006-1 2019-09-17
ZDB-ALT-090702-2 io006Tg io6, Tg(UAS:eGFP-HRAS_G12V)io006 Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Tg(UAS:EGFP-HRAS_G12V) ZDB-TGCONSTRCT-090702-1 2019-09-17
ZDB-ALT-090702-4 io007Tg Tg(XlEef1a1:dclk2DeltaK-GFP)io007 Transgenic Insertion embryos treated with DNA The dclk2DeltaK is a kinase dead version of dclk2. Mione Lab ZDB-LAB-050531-2 Unmapped Tg(Xla.Eef1a1:dclk2DeltaK-GFP) ZDB-TGCONSTRCT-090702-3 2019-09-17
ZDB-ALT-090707-1 io008Tg Tg(XlEef1a1:dclk2-GFP)io008 Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Tg(Xla.Eef1a1:dclk2a-GFP) ZDB-TGCONSTRCT-090707-1 2019-09-17
ZDB-ALT-100303-1 io009Tg io9, Tg(-1.8pknox1.1:EGFP)io009, Tg( -1.8pknox1.1:eGFP)io9, Tg(-1.8pknox1.1:eGFP)io9, Tg(-1.8pknox1.1:EGFP)io9 Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Tg(-1.8pknox1.1:EGFP) ZDB-TGCONSTRCT-100303-1 2019-09-17
ZDB-ALT-090504-3 io1Gt Gt(GFP-H-RASV12)io1, Gt(T2kSAG:EGFP-HRAS_G12V)io1 Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Gt(T2kSAG:GFP-HRAS_G12V) ZDB-GTCONSTRCT-130122-1 2019-09-17
ZDB-ALT-090504-4 io2Gt Gt(GFP-H-RASV12)io2, Gt(T2kSAG:EGFP-HRAS_G12V)io2 Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Gt(T2kSAG:GFP-HRAS_G12V) ZDB-GTCONSTRCT-130122-1 2019-09-17
ZDB-ALT-090504-8 io3Tg Tg(hsp70I:EGFP-HRASV12), Tg(hsp70l:eGFP-HRAS_G12V)io3 Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Tg(hsp70l:EGFP-HRAS_G12V) ZDB-TGCONSTRCT-090504-3 2019-09-17
ZDB-ALT-170406-1 ion13dTg Transgenic Insertion embryos treated with DNA Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg2(elavl3:GCaMP5G) ZDB-TGCONSTRCT-151229-1 2019-09-17
ZDB-ALT-160411-7 ion14dTg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR1-tph2 Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg(UAS:GCaMP5) ZDB-TGCONSTRCT-160411-7 2019-09-17
ZDB-ALT-170918-18 ion17dTg Transgenic Insertion embryos treated with DNA Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg(ctbp2a:Cr.ChR2-CFP) ZDB-TGCONSTRCT-170918-4 2019-09-17
ZDB-ALT-170913-1 ion1hTg Transgenic Insertion embryos treated with DNA Jie He Lab ZDB-LAB-170209-10 Unmapped Tg(actc1b:Hsa.HIST1H2BJ-CFP) ZDB-TGCONSTRCT-170913-1 2019-09-17
ZDB-ALT-160411-6 ion21dTg Transgenic Insertion embryos treated with DNA Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg(slc6a3:GAL4-VP16) ZDB-TGCONSTRCT-160411-6 2019-09-17
ZDB-ALT-160411-5 ion25dTg Transgenic Insertion embryos treated with DNA Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg(slc6a3:Cr.ChR2-ECFP) ZDB-TGCONSTRCT-160411-8 2019-09-17
ZDB-ALT-170327-16 ion27Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR5-th Jiu-Lin Du Lab ZDB-LAB-151217-1 Chr: 25 Tg(:2A-EGFP) ZDB-TGCONSTRCT-170327-3 2019-09-17
ZDB-ALT-170906-1 ion2hTg Transgenic Insertion embryos treated with DNA Jie He Lab ZDB-LAB-170209-10 Unmapped Tg(rx2:d2EGFP) ZDB-TGCONSTRCT-170906-3 2019-09-17
ZDB-ALT-170327-17 ion32Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR5-th Jiu-Lin Du Lab ZDB-LAB-151217-1 Chr: 25 Tg(:2A-GAL4) ZDB-TGCONSTRCT-170327-4 2019-09-17
ZDB-ALT-171120-1 ion33dTg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA and CRISPR Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg(GAL4-VP16) ZDB-TGCONSTRCT-171121-1 2019-09-17
ZDB-ALT-170327-20 ion38Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR2-kdrl Jiu-Lin Du Lab ZDB-LAB-151217-1 Chr: 14 Tg(:2A-EGFP) ZDB-TGCONSTRCT-170327-3 2019-09-17
ZDB-ALT-170327-18 ion39Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR1-tph2 Jiu-Lin Du Lab ZDB-LAB-151217-1 Chr: 18 Tg(:2A-EGFP) ZDB-TGCONSTRCT-170327-3 2019-09-17
ZDB-ALT-170906-2 ion3hTg Transgenic Insertion embryos treated with DNA Jie He Lab ZDB-LAB-170209-10 Unmapped TgBAC(kdrl:mCherry-CAAX) ZDB-TGCONSTRCT-170906-2 2019-09-17
ZDB-ALT-170327-19 ion44Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with CRISPR2-gfap Jiu-Lin Du Lab ZDB-LAB-151217-1 Chr: 3 Tg(:2A-EGFP) ZDB-TGCONSTRCT-170327-3 2019-09-17
ZDB-ALT-181219-1 ion6dTg Transgenic Insertion embryos treated with DNA Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg(pou4f3:GAL4-VP16) ZDB-TGCONSTRCT-181219-1 2019-09-17
ZDB-ALT-181219-2 ion7dTg Transgenic Insertion embryos treated with DNA Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg(14xUAS-E1B:sypb-EGFP) ZDB-TGCONSTRCT-181219-2 2019-09-17
ZDB-ALT-160725-2 ion8dTg Transgenic Insertion embryos treated with DNA Jiu-Lin Du Lab ZDB-LAB-151217-1 Unmapped Tg5(elavl3:GAL4-VP16) ZDB-TGCONSTRCT-160725-1 2019-09-17
ZDB-ALT-171122-1 ioz10 Small Deletion embryos treated with CRISPR1-admp 132-142 bp of the wildtype admp coding sequence is deleted. The mutated admp codes for a truncated protein containing 72 aa, 43 aa of which is identical to wildtype admp. Qiang Wang Lab ZDB-LAB-161004-2 Ambiguous 2019-09-17
ZDB-ALT-161010-9 ioz100 Indel embryos treated with TALEN2-fscn1a Qiang Wang Lab ZDB-LAB-161004-2 Chr: 3 2019-09-17
ZDB-ALT-170511-1 ioz101 net1Δ53 Small Deletion embryos treated with CRISPR2-net1 Qiang Wang Lab ZDB-LAB-161004-2 Chr: 4 2019-09-17
ZDB-ALT-171019-1 ioz102 Small Deletion embryos treated with CRISPR1-klf6a Liu Lab ZDB-LAB-110907-1 Chr: 24 2019-09-17
ZDB-ALT-180306-1 ioz103 Indel embryos treated with CRISPR1-dnmt3bb.1 An 11-bp insertion in the third exon (236 bp after the start codon), resulting in an 87 amino acid polypeptide. Liu Lab ZDB-LAB-110907-1 Chr: 23 2019-09-17
ZDB-ALT-171122-2 ioz11 Small Deletion embryos treated with CRISPR1-im:7138239 The transcription start site of the im:7138239 gene has been deleted. Qiang Wang Lab ZDB-LAB-161004-2 Chr: 2 2019-09-17
ZDB-ALT-171129-1 ioz12 Insertion embryos treated with CRISPR1-mettl3 Liu Lab ZDB-LAB-110907-1 Chr: 7 2019-09-17
ZDB-ALT-180118-1 ioz13 Small Deletion embryos treated with TALEN1-mir142a the mutation disrupts the secondary structure of miR-142a as well as the formation of mature miR-142a-
3p Liu Lab ZDB-LAB-110907-1 Chr: 5 2019-09-17
ZDB-ALT-180118-2 ioz14 Small Deletion embryos treated with CRISPR1-mir142a, CRISPR2-mir142a Mutation impairs secondary RNA structure of miR-142a and induces failure to form the mature miR-142a-3p Liu Lab ZDB-LAB-110907-1 Chr: 5 2019-09-17
ZDB-ALT-190426-1 ioz15Tg Transgenic Insertion Qiang Wang Lab ZDB-LAB-161004-2 Unmapped Tg(-5.5nkx2.3:mCherry) ZDB-TGCONSTRCT-190426-1 2019-09-17
ZDB-ALT-190426-2 ioz16Tg Transgenic Insertion embryos treated with DNA Qiang Wang Lab ZDB-LAB-161004-2 Unmapped Tg(-5.5nkx2.3:EGFP-CAAX) ZDB-TGCONSTRCT-190426-2 2019-09-17
ZDB-ALT-190426-3 ioz17Tg Transgenic Insertion embryos treated with DNA Qiang Wang Lab ZDB-LAB-161004-2 Unmapped Tg(-5.5nkx2.3:EosFP) ZDB-TGCONSTRCT-190426-3 2019-09-17
ZDB-ALT-190426-4 ioz18Tg Transgenic Insertion embryos treated with DNA Qiang Wang Lab ZDB-LAB-161004-2 Unmapped Tg(-5.5nkx2.3:nog3-mCherry) ZDB-TGCONSTRCT-190426-4 2019-09-17
ZDB-ALT-190430-1 ioz19Tg Transgenic Insertion embryos treated with DNA Qiang Wang Lab ZDB-LAB-161004-2 Unmapped Tg(-5.5nkx2.3:KALTA4-mCherry) ZDB-TGCONSTRCT-190426-5 2019-09-17
ZDB-ALT-150820-1 ioz1Tg Transgenic Insertion embryos treated with DNA Liu Lab ZDB-LAB-110907-1 Unmapped Tg(Mmu.Runx1:GFP) ZDB-TGCONSTRCT-150820-1 2019-09-17
ZDB-ALT-190520-7 ioz20 Small Deletion embryos treated with CRISPR1-admp 133-143 bp of the wildtype admp coding sequence is deleted. The mutated admp codes for a truncated protein containing 72 aa, 44 aa of which is identical to wildtype admp. Qiang Wang Lab ZDB-LAB-161004-2 Ambiguous 2019-09-17
ZDB-ALT-190522-1 ioz21 Small Deletion embryos treated with CRISPR1-dmrt2b Qiang Wang Lab ZDB-LAB-161004-2 Chr: 6 2019-09-17
ZDB-ALT-190528-1 ioz22Tg Transgenic Insertion embryos treated with DNA Qiang Wang Lab ZDB-LAB-161004-2 Unmapped Tg(-4.9sox10:mCherry-CAAX) ZDB-TGCONSTRCT-190528-1 2019-09-17
ZDB-ALT-160218-1 ioz2Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with TALEN1-irf4a Liu Lab ZDB-LAB-110907-1 Chr: 2 Tg(-1.9irf4a:GFP) ZDB-TGCONSTRCT-160217-4 2019-09-17
ZDB-ALT-160817-6 ioz3 Small Deletion embryos treated with TALEN1-irf4a Liu Lab ZDB-LAB-110907-1 Chr: 2 2019-09-17
ZDB-ALT-161130-2 ioz4Tg Transgenic Insertion embryos treated with DNA Qiang Wang Lab ZDB-LAB-161004-2 Unmapped Tg(tg:EGFP) ZDB-TGCONSTRCT-161130-2 2019-09-17
ZDB-ALT-170113-15 ioz5 net1Δ20 Indel embryos treated with CRISPR2-net1 GCCAGACCCTCCAGGCCTCA is deleted and C is inserted Qiang Wang Lab ZDB-LAB-161004-2 Chr: 4 2019-09-17
ZDB-ALT-170113-16 ioz6 Indel embryos treated with CRISPR GTCCAGTC is mutated to C Qiang Wang Lab ZDB-LAB-161004-2 Chr: 3 2019-09-17
ZDB-ALT-170113-17 ioz7Tg Transgenic Insertion embryos treated with DNA Qiang Wang Lab ZDB-LAB-161004-2 Unmapped Tg(gsc:GFP) ZDB-TGCONSTRCT-170113-7 2019-09-17
ZDB-ALT-170119-4 ioz8 Insertion embryos treated with CRISPR1-bloc1s2 Liu Lab ZDB-LAB-110907-1 Chr: 20 2019-09-17
ZDB-ALT-170331-1 ioz9 Small Deletion embryos treated with CRISPR1-gpr183a deletion is at 292 base pairs after the start codon. Liu Lab ZDB-LAB-110907-1 Chr: 9 2019-09-17
ZDB-ALT-120607-1 ip1Tg Tg(ifnphi1:mCherryF), Tg(ifnphi1:mCherry)ip1 Transgenic Insertion embryos treated with DNA Herbomel Lab ZDB-LAB-970903-4 Unmapped Tg(ifnphi1:mCherry) ZDB-TGCONSTRCT-120607-1 2019-09-17
ZDB-ALT-120607-2 ip2Tg Tg(ifnphi1:mCherryF), Tg(ifnphi1:mCherry)ip2 Transgenic Insertion embryos treated with DNA Herbomel Lab ZDB-LAB-970903-4 Unmapped Tg(ifnphi1:mCherry) ZDB-TGCONSTRCT-120607-1 2019-09-17
ZDB-ALT-170131-4 ip3Tg Transgenic Insertion embryos treated with DNA Bally-Cuif Lab ZDB-LAB-990226-15 Unmapped Tg(her4.1:RTTA,myl7:EGFP) ZDB-TGCONSTRCT-170131-4 2019-09-17
ZDB-ALT-170131-5 ip4Tg Transgenic Insertion embryos treated with DNA Bally-Cuif Lab ZDB-LAB-990226-15 Unmapped Tg(TETRE:h2az2a-mCherry,TETRE:EGFP,cryaa:Venus) ZDB-TGCONSTRCT-170131-5 2019-09-17
ZDB-ALT-181115-10 ip5Tg Transgenic Insertion embryos treated with DNA Herbomel Lab ZDB-LAB-970903-4 Unmapped Tg(kdrl:myl9a-EGFP) ZDB-TGCONSTRCT-181115-7 2019-09-17
ZDB-ALT-181115-11 ip6Tg Transgenic Insertion embryos treated with DNA Herbomel Lab ZDB-LAB-970903-4 Unmapped Tg(kdrl:myl9b-EGFP) ZDB-TGCONSTRCT-181115-8 2019-09-17
ZDB-ALT-190620-8 ip7 Small Deletion Herbomel Lab ZDB-LAB-970903-4 Unmapped 2019-09-17
ZDB-ALT-121112-2 ipk1Tg This feature is representative of one or more unknown insertion sites. ZM_00007837 Transgenic Insertion embryos treated with DNA Gründemann Lab ZDB-LAB-121109-1 Chr: 21 Tg(ZM) ZDB-TGCONSTRCT-101007-1 2019-09-17
ZDB-ALT-120418-23 ir1040Tg Tg(-4.9sox10:LMA-Tomato)ir1040 Transgenic Insertion embryos treated with DNA Schilling Lab ZDB-LAB-000222-7 Unmapped Tg(-4.9sox10:LY-Tomato) ZDB-TGCONSTRCT-120418-23 2019-09-17
ZDB-ALT-190715-6 ir1090 Small Deletion embryos treated with CRISPR1-mipa Schilling Lab ZDB-LAB-000222-7 Chr: 23 2019-09-17
ZDB-ALT-190715-7 ir1091 Small Deletion embryos treated with CRISPR1-mipb Schilling Lab ZDB-LAB-000222-7 Chr: 23 2019-09-17
ZDB-ALT-120215-9 ir1189Tg p77, Tg(5xBMPRE-Xla.Id3:GFP)ir1189 Transgenic Insertion embryos treated with DNA Schilling Lab ZDB-LAB-000222-7 Unmapped Tg(5xBMPRE-Xla.Id3:GFP) ZDB-TGCONSTRCT-120215-4 2019-09-17
ZDB-ALT-120418-22 ir866Tg Tg(-4.9sox10:LMA-GFP)ir866 Transgenic Insertion embryos treated with DNA Schilling Lab ZDB-LAB-000222-7 Unmapped Tg(-4.9sox10:LY-GFP) ZDB-TGCONSTRCT-120418-22 2019-09-17
ZDB-ALT-080228-1 ir937Tg Tg(-7.2sox10:EGFP)ir937, Tg(-7.2sox10:EGFP)zf77, zf77 Transgenic Insertion embryos treated with DNA Schilling Lab ZDB-LAB-000222-7 Unmapped Tg(-7.2sox10:EGFP) ZDB-TGCONSTRCT-080228-2 2019-09-17
ZDB-ALT-141003-1 iro1Tg Transgenic Insertion embryos treated with DNA Institut de Recherche en Ophtalmologie (IRO) ZDB-LAB-070723-1 Unmapped Tg(hsp70l:hmx1,myl7:EGFP) ZDB-TGCONSTRCT-141003-1 2019-09-17
ZDB-ALT-151120-1 is10Gt This feature is representative of one or more unknown insertion sites. is10Tg Transgenic Insertion embryos treated with DNA Craig et al (2015): gene trap vector insertion in the third intron of fli1a gene. The insertion causes a truncation of the sterile alpha motif/pointed protein-binding domain, and the resulting Fli1a protein is predicted to lack the C-terminal ETS DNA-binding domain. Essner Lab ZDB-LAB-100204-1 Chr: 18 Gt(:LOXP-EGFP-LOXP) ZDB-GTCONSTRCT-151120-1 2019-09-17
ZDB-ALT-150406-1 is18Tg This feature is representative of one or more unknown insertion sites. Transgenic Insertion embryos treated with DNA line contains an array with ~ 100 copies of the Tol2 construct McGrail Lab ZDB-LAB-120216-1 Unmapped Tg(kdrl:RFP-CAAX) ZDB-TGCONSTRCT-150406-1 2019-09-17
ZDB-ALT-120302-1 is19Tg Tg(kdrl:TagRFP-CAAX)is19 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(kdrl:TagRFP-CAAX) ZDB-TGCONSTRCT-120302-1 2019-09-17
ZDB-ALT-110127-21 is1Tg Tg(kdrl:msna-EGFP)is1 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(kdrl:msna-EGFP) ZDB-TGCONSTRCT-110127-19 2019-09-17
ZDB-ALT-120328-1 is22Gt This feature is representative of one or more unknown insertion sites. Gt(GBT-R15)is22 Transgenic Insertion embryos treated with DNA The insertion site is located in intron 4 of the appa gene. McGrail Lab ZDB-LAB-120216-1 Chr: 1 Gt(GBT-R15) ZDB-GTCONSTRCT-100121-2 2019-09-17
ZDB-ALT-120328-2 is23Gt This feature is representative of one or more unknown insertion sites. Gt(GBT-R15)is23 Transgenic Insertion embryos treated with DNA The insertion is located in intron 12 of the aplp2 gene. McGrail Lab ZDB-LAB-120216-1 Chr: 18 Gt(GBT-R15) ZDB-GTCONSTRCT-100121-2 2019-09-17
ZDB-ALT-110127-22 is2Tg Tg(kdrl:mCherry-bactin1)is2 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(kdrl:mCherry-actb1) ZDB-TGCONSTRCT-110127-20 2019-09-17
ZDB-ALT-110127-23 is3Tg Tg(kdrl:ctnna-EGFP)is3 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(kdrl:ctnna-EGFP) ZDB-TGCONSTRCT-110127-21 2019-09-17
ZDB-ALT-110127-24 is4Tg Tg(kdrl:nlsmCherry)is4 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(kdrl:NLS-mCherry) ZDB-TGCONSTRCT-110127-22 2019-09-17
ZDB-ALT-151016-3 is51 e2e5del Indel embryos treated with TALEN1-si:ch211-246i5.4 TALENs targeting exons 2 and 5 create a 147 kb deletion in si:ch211-246i5.4 gene and fuses exon 2 to exon 5 McGrail Lab ZDB-LAB-120216-1 Chr: 3 2019-09-17
ZDB-ALT-181019-3 is54 7bp deletion Small Deletion embryos treated with TALEN2-rb1 McGrail Lab ZDB-LAB-120216-1 Chr: 21 2019-09-17
ZDB-ALT-181019-4 is56Tg Transgenic Insertion embryos treated with DNA McGrail Lab ZDB-LAB-120216-1 Unmapped Tg(ubb:DsRed) ZDB-TGCONSTRCT-181019-1 2019-09-17
ZDB-ALT-110127-25 is5Tg Tg(kdrl:mCherry)is5 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(kdrl:mCherry) ZDB-TGCONSTRCT-110127-23 2019-09-17
ZDB-ALT-181022-1 is60 Small Deletion embryos treated with CRISPR1-rbbp4 McGrail Lab ZDB-LAB-120216-1 Chr: 19 2019-09-17
ZDB-ALT-110127-26 is6Tg Tg(bactin1:RFP)is6, Tg(T2OncZ, bactin1:RFP)is6 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(T2OncZ,actb1:RFP) ZDB-TGCONSTRCT-110127-24 2019-09-17
ZDB-ALT-181022-2 is70 Small Deletion embryos treated with CRISPR1-hdac1 McGrail Lab ZDB-LAB-120216-1 Chr: 19 2019-09-17
ZDB-ALT-110616-3 is7Tg Tg(bactin1:RFP)is7, Tg(T2OncZ, bactin1:RFP)is7 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(T2OncZ,actb1:RFP) ZDB-TGCONSTRCT-110127-24 2019-09-17
ZDB-ALT-110627-6 is8Tg Tg(bactin1:sb11,myl7:GFP)is8 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(actb1:sb11,myl7:GFP) ZDB-TGCONSTRCT-110627-3 2019-09-17
ZDB-ALT-110627-7 is9Tg Tg(bactin1:sb11,myl7:GFP)is9 Transgenic Insertion embryos treated with DNA Essner Lab ZDB-LAB-100204-1 Unmapped Tg(actb1:sb11,myl7:GFP) ZDB-TGCONSTRCT-110627-3 2019-09-17
ZDB-ALT-120412-3 isc1Tg Tg(actb1:EGFP-Hsa.HRAS)isc1 Transgenic Insertion embryos treated with DNA Peyriéras Lab ZDB-LAB-111117-1 Unmapped Tg(actb1:EGFP-Hsa.HRAS) ZDB-TGCONSTRCT-120412-2 2019-09-17
ZDB-ALT-120711-1 isc2Tg Tg(actb1:hist2h2l-mCherry)isc2 Transgenic Insertion embryos treated with DNA Peyriéras Lab ZDB-LAB-111117-1 Unmapped Tg(actb1:hist2h2l-mCherry) ZDB-TGCONSTRCT-120711-1 2019-09-17
ZDB-ALT-131212-3 isc3Tg Tg(-4gsc:EGFP)isc3 Transgenic Insertion embryos treated with DNA Peyriéras Lab ZDB-LAB-111117-1 Unmapped Tg(-4gsc:EGFP) ZDB-TGCONSTRCT-131212-1 2019-09-17
ZDB-ALT-131212-2 isc4Tg Tg(-4gsc:eGFP-Hsa.HRAS)isc4 Transgenic Insertion DNA Peyriéras Lab ZDB-LAB-111117-1 Unmapped Tg(-4gsc:EGFP-Hsa.HRAS) ZDB-TGCONSTRCT-131212-2 2019-09-17
ZDB-ALT-131204-3 isc5Tg Tg(Gga.Egr2:hist2h2l-mCherry)isc5 Transgenic Insertion embryos treated with DNA Peyriéras Lab ZDB-LAB-111117-1 Unmapped Tg(Gga.Egr2:hist2h2l-mCherry) ZDB-TGCONSTRCT-131204-2 2019-09-17
ZDB-ALT-090520-12 it275 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Chr: 24 2019-09-17
ZDB-ALT-181128-5 it312 Small Deletion embryos treated with CRISPR The 7 bp deletion generates a frameshift after amino acid 783. Kobayashi Lab ZDB-LAB-980622-1 Chr: 13 2019-09-17
ZDB-ALT-110304-1 it416aTg Tg(-3.5gstp1:EGFP)it416a Transgenic Insertion embryos treated with DNA Kobayashi Lab ZDB-LAB-980622-1 Unmapped Tg(-3.5gstp1:EGFP) ZDB-TGCONSTRCT-110304-1 2019-09-17
ZDB-ALT-110304-2 it416bTg Tg(-3.5gstp1:EGFP)it416b Transgenic Insertion embryos treated with DNA Kobayashi Lab ZDB-LAB-980622-1 Unmapped Tg(-3.5gstp1:EGFP) ZDB-TGCONSTRCT-110304-1 2019-09-17
ZDB-ALT-090520-9 it567 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Unmapped 2019-09-17
ZDB-ALT-160314-4 it627 Point Mutation ENU Takeuchi et al (2015): C-to-T nonsense mutation in exon 17; respectively).\nThe mutation replaces Gln609 with a stop codon that leads to an ∼200-aa truncation of AOD-C. AOD-C contains the FAD- and substrate-binding subdomains, suggesting that the truncation eliminates its enzymatic activity. Analysis indicate that this mutation is a null mutation of lsd1 in zebrafish. Kobayashi Lab ZDB-LAB-980622-1 Ambiguous 2019-09-17
ZDB-ALT-090520-13 it664 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Unmapped 2019-09-17
ZDB-ALT-090520-14 it768 Point Mutation adult males treated with ENU Most of the sequenced cDNAs from this mutant contain a 30 nucleotide in-frame deletion. This would result in a 10 amino acid deletion, including the deletion of an Arg corresponding to Arg141 in human PMM2, a residue which is highly conserved, and is crucial for substrate binding. Kobayashi Lab ZDB-LAB-980622-1 Chr: 1 2019-09-17
ZDB-ALT-090520-15 it817 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Unmapped 2019-09-17
ZDB-ALT-090520-16 it836 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Unmapped 2019-09-17
ZDB-ALT-090520-10 it840 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Unmapped 2019-09-17
ZDB-ALT-090520-11 it864 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Unmapped 2019-09-17
ZDB-ALT-090520-17 it949 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Unmapped 2019-09-17
ZDB-ALT-090520-18 it983 Unknown adult males treated with ENU Kobayashi Lab ZDB-LAB-980622-1 Unmapped 2019-09-17
ZDB-ALT-050622-2 itga5_unspecified un_itga5, unspecified_itga5 Unspecified Chr: 23 2019-09-17
ZDB-ALT-160406-2 iu2Tg Transgenic Insertion embryos treated with DNA Anderson Lab ZDB-LAB-100922-1 Unmapped Tg(hsp70l:LOXP-mCherry-STOP-LOXP-dnirs2b-EGFP,cryaa:Cerulean) ZDB-TGCONSTRCT-160406-2 2019-09-17
ZDB-ALT-040825-4 j1013aGt Gt(T2KSAG)j1013a, j1013a, Tg(T2kSAG:GFP), Tg(T2kSAG:GFP)j1013a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-040825-6 j1015aGt Gt(T2KSAG)j1015a, j1015a, Tg(T2kSAG:GFP), Tg(T2kSAG:GFP)j1015a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-1 j1016bGt Gt(T2KSAG)j1016b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-2 j1019aGt Gt(T2KSAG)j1019a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-050130-10 j101e1 Unknown Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 17 2019-09-17
ZDB-ALT-100209-3 j1023aGt Gt(T2KSAG)j1023a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-4 j1023dGt Gt(T2KSAG)j1023d Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-040825-8 j1023hGt Gt(T2KSAG)j1023h, j1023h, Tg(T2kSAG:GFP), Tg(T2kSAG:GFP)j1023h Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-6 j1023iGt Gt(T2KSAG)j1023i Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-041015-2 j1024aGt Gt(T2KSAG)j1024a, j1024a, Tg(T2kSAG:GFP), Tg(T2kSAG:GFP)j1024a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-7 j1031aGt Gt(T2KSAG)j1031a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-040825-10 j1039aGt Gt(T2KSAG)j1039a, j1039a, Tg(T2kSAG:GFP), Tg(T2kSAG:GFP)j1039a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-8 j1039cGt Gt(T2KSAG)j1039c Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-040825-2 j1042aGt Gt(T2KSAG)j1042a, j1042a, Tg(T2kSAG:GFP), Tg(T2kSAG:GFP)j1042a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100211-1 j1043bGt Gt(T2KSAG)j1043b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100211-2 j1046aGt Gt(T2KSAG)j1046a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100211-3 j1057aGt Gt(T2KSAG)j1057a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-9 j1057bGt Gt(T2KSAG)j1057b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-10 j1071aGt Gt(T2KSAG)j1071a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-11 j1073aGt This feature is representative of one or more unknown insertion sites. Gt(T2KSAG)j1073a, j1073a Transgenic Insertion embryos treated with DNA Transposon inserted in the first exon of dlx5a generates a loss-of-function allele of dlx5a. The GFP-coding sequence is in opposite orientation to dlx5a. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 19 Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-26 j108e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 7 2019-09-17
ZDB-ALT-041117-2 j1090aGt Gt(T2KSAG)j1090a, j1090a, Tg(T2kSAG:GFP), Tg(T2kSAG:GFP)j1090a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-041015-4 j1097bGt Gt(T2KSAG)j1097b, j1097b, Tg(T2kSAG:GFP), Tg(T2kSAG:GFP)j1097b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-12 j1097eGt Gt(T2KSAG)j1097e Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-13 j1098aGt Gt(T2KSAG)j1098a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-31 j1098bGt Gt(T2KSAG)j1098b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-30 j1098cGt Gt(T2KSAG)j1098c Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-29 j1099aGt Gt(T2KSAG)j1099a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-021202-2 j10e1 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 2019-09-17
ZDB-ALT-100209-14 j1104aGt Gt(T2KSAG)j1104a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-15 j1146bGt Gt(T2KSAG)j1146b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-030429-2 j115e1 j115el Point Mutation ENU homozygous viable allele resulting from T->A transversion in tuba8l3 gene at position 747 of the ORF, resulting in a non-conservative amino acid substitution at residue 249 of the predicted protein, exchanging asn for lys ( Larson et al. ZDB-PUB-100811-9 ) Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 9 2019-09-17
ZDB-ALT-100212-28 j1171aGt Gt(T2KSAG)j1171a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-16 j1171bGt Gt(T2KSAG)j1171b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-27 j1176aGt Gt(T2KSAG)j1176a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-26 j1178aGt Gt(T2KSAG)j1178a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-17 j1184bGt Gt(T2KSAG)j1184b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-25 j1185aGt Gt(T2KSAG)j1185a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-101007-1 j1186aGt Gt(T2KSAG)j1186a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-24 j1188aGt Gt(T2KSAG)j1188a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-32 j118e1 j117e1 Unknown ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-100212-23 j1191aGt Gt(T2KSAG)j1191a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-22 j1193aGt Gt(T2KSAG)j1193a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-21 j1193bGt Gt(T2KSAG)j1193b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100915-5 j1197aGt Gt(T2KSAG)j1197a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-021023-2 j119e1 Unknown ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-080515-1 j120 Nermal Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 6 2019-09-17
ZDB-ALT-100915-6 j1203bGt Gt(T2KSAG)j1203b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-20 j1204aGt Gt(T2KSAG)j1204a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100827-1 j1204bGt Gt(T2KSAG)j1204b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-34 j120e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 22 2019-09-17
ZDB-ALT-020731-8 j121e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 25 2019-09-17
ZDB-ALT-020731-12 j121e2 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 25 2019-09-17
ZDB-ALT-020731-6 j121e3 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 25 2019-09-17
ZDB-ALT-020731-10 j121e4 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 25 2019-09-17
ZDB-ALT-100212-19 j1223bGt Gt(T2KSAG)j1223b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-18 j1226aGt Gt(T2KSAG)j1226a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-17 j1229aGt Gt(T2KSAG)j1229a Transgenic Insertion embryos treated with DNA j1229a has been carried for several generations to produce a single insertion site line. The insertion site was identified as chr11:9,246,478 bp (ZV7 assembly) (Burgess et al. 2009) Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-2 j122e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-110120-1 j122s1 mohawk Point Mutation spontaneous This mutation is a T to C transition: T962C. This results in an amino acid change of Phe to Ser. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 17 2019-09-17
ZDB-ALT-100209-18 j1233aGt Gt(T2KSAG)j1233a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-16 j1235bGt Gt(T2KSAG)j1235b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-15 j1235cGt Gt(T2KSAG)j1235c Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-14 j1237aGt Gt(T2KSAG)j1237a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-24 j123e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-021118-2 j124e1 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 18 2019-09-17
ZDB-ALT-050810-2 j124e2 Unknown ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 18 2019-09-17
ZDB-ALT-100212-13 j1253aGt Gt(T2KSAG)j1253a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-18 j125e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-100212-12 j1261eGt Gt(T2KSAG)j1261e Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-19 j1262aGt Gt(T2KSAG)j1262a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-11 j1262bGt Gt(T2KSAG)j1262b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-10 j1264aGt Gt(T2KSAG)j1264a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-101007-2 j1265aGt Gt(T2KSAG)j1265a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-9 j1267aGt Gt(T2KSAG)j1267a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-16 j126e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-020731-14 j126e2 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-100212-32 j1271aGt This feature is representative of one or more unknown insertion sites. Gt(T2KSAG)j1271a, j1271a, trps1:EGFP, trps1:GFP Transgenic Insertion embryos treated with DNA "...the J1271a insertion is at chr19: 43671269, inside the first intron of trps1..." Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 19 Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-7 j1271eGt Gt(T2KSAG)j1271e Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-6 j1271fGt Gt(T2KSAG)j1271f Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-101007-3 j1271iGt Gt(T2KSAG)j1271i Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-5 j1272cGt Gt(T2KSAG)j1272c Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-4 j1274bGt Gt(T2KSAG)j1274b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-22 j127e1 Unknown ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-100212-3 j1280aGt Gt(T2KSAG)j1280a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-120221-10 j1282bGt Gt(T2KSAG)j1282b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100212-2 j1283aGt Gt(T2KSAG)j1283a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-20 j1284aGt Gt(T2KSAG)j1284a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-21 j1284cGt Gt(T2KSAG)j1284c Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-100209-22 j1286aGt Gt(T2KSAG)j1286a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-20 j128e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-100212-1 j1291aGt Gt(T2KSAG)j1291a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Gt(T2KSAG) ZDB-GTCONSTRCT-070430-1 2019-09-17
ZDB-ALT-020731-4 j129e1 Unknown ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-131018-2 j130 Small Deletion spontaneous this slc45a5 mutant possesses a 6 nt deletion in exon 6 that results in a 2aa deletion (422-423=PY) Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 18 2019-09-17
ZDB-ALT-020731-30 j130e1 Unknown adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-090827-1 j131 Point Mutation adult males treated with ENU A T to A chane creates a site for ApaLI and causes a L to H change in the protein sequence. Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-150923-1 j131x8 Small Deletion sperm treated with g-rays This is a revertant of the ty86d mutant. PCR analysis showed a 384 bp deletion in the kcnk5b gene leading to a frameshift and a premature termination codon. The resulting protein lacks the 3 transmembrane domains. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-110120-3 j15 Unknown Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-091106-2 j1601Tg Tg(Xla.eef1a1:EGFP)j1601, Tg(XlEef1a1:EGFP)j1601 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 23 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-3 j1602Tg Tg(Xla.eef1a1:EGFP)j1602, Tg(XlEef1a1:EGFP)j1602 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-4 j1603Tg Tg(Xla.eef1a1:EGFP)j1603, Tg(XlEef1a1:EGFP)j1603 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 5 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-5 j1604Tg Tg(Xla.eef1a1:EGFP)j1604, Tg(XlEef1a1:EGFP)j1604 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 8 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-6 j1605Tg Tg(Xla.eef1a1:EGFP)j1605, Tg(XlEef1a1:EGFP)j1605 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 18 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-7 j1606Tg Tg(Xla.eef1a1:EGFP)j1606, Tg(XlEef1a1:EGFP)j1606 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-8 j1607aTg Tg(Xla.eef1a1:EGFP)j1607a, Tg(XlEef1a1:EGFP)j1607a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 9 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-9 j1607cTg Tg(Xla.eef1a1:EGFP)j1607c, Tg(XlEef1a1:EGFP)j1607c Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 23 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-10 j1608Tg Tg(Xla.eef1a1:EGFP)j1608, Tg(XlEef1a1:EGFP)j1608 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-11 j1609aTg Tg(Xla.eef1a1:EGFP)j1609a, Tg(XlEef1a1:EGFP)j1609a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 15 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-12 j1609bTg Tg(Xla.eef1a1:EGFP)j1609b, Tg(XlEef1a1:EGFP)j1609b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 13 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-13 j1610Tg Tg(Xla.eef1a1:EGFP)j1610, Tg(XlEef1a1:EGFP)j1610 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-14 j1611Tg Tg(Xla.eef1a1:EGFP)j1611, Tg(XlEef1a1:EGFP)j1611 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-15 j1612Tg Tg(Xla.eef1a1:EGFP)j1612, Tg(XlEef1a1:EGFP)j1612 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 6 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-16 j1613Tg Tg(Xla.eef1a1:EGFP)j1613, Tg(XlEef1a1:EGFP)j1613 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 8 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-17 j1614Tg Tg(Xla.eef1a1:EGFP)j1614, Tg(XlEef1a1:EGFP)j1614 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 2 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-19 j1615bTg Tg(Xla.eef1a1:EGFP)j1615b, Tg(XlEef1a1:EGFP)j1615b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-20 j1615cTg Tg(Xla.eef1a1:EGFP)j1615c, Tg(XlEef1a1:EGFP)j1615c Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 23 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-21 j1616Tg Tg(Xla.eef1a1:EGFP)j1616, Tg(XlEef1a1:EGFP)j1616 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 16 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-18 j1617Tg Tg(Xla.eef1a1:EGFP)j1617, Tg(XlEef1a1:EGFP)j1617 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 8 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-22 j1618Tg Tg(Xla.eef1a1:EGFP)j1618, Tg(XlEef1a1:EGFP)j1618 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-23 j1619Tg Tg(Xla.eef1a1:EGFP)j1619, Tg(XlEef1a1:EGFP)j1619 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-24 j1620Tg Tg(Xla.eef1a1:EGFP)j1620, Tg(XlEef1a1:EGFP)j1620 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 17 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-25 j1621Tg Tg(Xla.eef1a1:EGFP)j1621, Tg(XlEef1a1:EGFP)j1621 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 5 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-26 j1622Tg Tg(Xla.eef1a1:EGFP)j1622, Tg(XlEef1a1:EGFP)j1622 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-27 j1623Tg Tg(Xla.eef1a1:EGFP)j1623, Tg(XlEef1a1:EGFP)j1623 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-28 j1625aTg Tg(Xla.eef1a1:EGFP)j1625a, Tg(XlEef1a1:EGFP)j1625a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-29 j1625bTg Tg(Xla.eef1a1:EGFP)j1625b, Tg(XlEef1a1:EGFP)j1625b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-30 j1626Tg Tg(Xla.eef1a1:EGFP)j1626, Tg(XlEef1a1:EGFP)j1626 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 17 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-31 j1627Tg Tg(Xla.eef1a1:EGFP)j1627, Tg(XlEef1a1:EGFP)j1627 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 14 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-32 j1628Tg Tg(Xla.eef1a1:EGFP)j1628, Tg(XlEef1a1:EGFP)j1628 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 4 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-33 j1629Tg Tg(Xla.eef1a1:EGFP)j1629, Tg(XlEef1a1:EGFP)j1629 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-34 j1631Tg Tg(Xla.eef1a1:EGFP)j1631, Tg(XlEef1a1:EGFP)j1631 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 5 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-35 j1632Tg Tg(Xla.eef1a1:EGFP)j1632, Tg(XlEef1a1:EGFP)j1632 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 5 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-36 j1633Tg Tg(Xla.eef1a1:EGFP)j1633, Tg(XlEef1a1:EGFP)j1633 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 22 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-37 j1634Tg Tg(Xla.eef1a1:EGFP)j1634, Tg(XlEef1a1:EGFP)j1634 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-38 j1635Tg Tg(Xla.eef1a1:EGFP)j1635, Tg(XlEef1a1:EGFP)j1635 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 2 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-39 j1636Tg Tg(Xla.eef1a1:EGFP)j1636, Tg(XlEef1a1:EGFP)j1636 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-40 j1637aTg Tg(Xla.eef1a1:EGFP)j1637a, Tg(XlEef1a1:EGFP)j1637a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-41 j1637bTg Tg(Xla.eef1a1:EGFP)j1637b, Tg(XlEef1a1:EGFP)j1637b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-42 j1637cTg Tg(Xla.eef1a1:EGFP)j1637c, Tg(XlEef1a1:EGFP)j1637c Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-43 j1637dTg Tg(Xla.eef1a1:EGFP)j1637d, Tg(XlEef1a1:EGFP)j1637d Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-44 j1638Tg Tg(Xla.eef1a1:EGFP)j1638, Tg(XlEef1a1:EGFP)j1638 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 12 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-45 j1639Tg Tg(Xla.eef1a1:EGFP)j1639, Tg(XlEef1a1:EGFP)j1639 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 18 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-46 j1640Tg Tg(Xla.eef1a1:EGFP)j1640, Tg(XlEef1a1:EGFP)j1640 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-47 j1641Tg Tg(Xla.eef1a1:EGFP)j1641, Tg(XlEef1a1:EGFP)j1641 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 5 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-48 j1642aTg Tg(Xla.eef1a1:EGFP)j1642a, Tg(XlEef1a1:EGFP)j1642a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 13 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-49 j1642bTg Tg(Xla.eef1a1:EGFP)j1642b, Tg(XlEef1a1:EGFP)j1642b Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-50 j1643Tg Tg(Xla.eef1a1:EGFP)j1643, Tg(XlEef1a1:EGFP)j1643 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 15 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-51 j1644Tg Tg(Xla.eef1a1:EGFP)j1644, Tg(XlEef1a1:EGFP)j1644 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 14 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-091106-52 j1645Tg Tg(Xla.eef1a1:EGFP)j1645, Tg(XlEef1a1:EGFP)j1645 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 2 Tg(Xla.Eef1a1:EGFP) ZDB-TGCONSTRCT-070531-3 2019-09-17
ZDB-ALT-070423-1 j16e1 Point Mutation adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-111010-24 j1775Et This feature is representative of one or more unknown insertion sites. Et(UTRHsa.SKTV2L2:EGFP)j1775, j1775 Transgenic Insertion embryos treated with DNA The construct integrated 160bp upstream of lhfpl4a. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 6 Et(UTR-Hsa.SKTV2L2:EGFP) ZDB-ETCONSTRCT-111010-1 2019-09-17
ZDB-ALT-050130-12 j198e1 Unknown Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-050130-14 j199 Unknown Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-000921-4 j1e1 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-000921-6 j1e15 Unknown Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-060911-6 j1e177 Point Mutation adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-060403-4 j1e249 Point Mutation adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-000921-2 j1e41 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-000921-8 j1e56 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-060911-2 j1e60 Point Mutation adult males treated with ENU This mutation is a T to C transition. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-060911-4 j1e78 Point Mutation adult males treated with ENU This mutation is a G to A transition. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-060911-8 j1e89 Point Mutation adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-020715-6 j1e99 Point Mutation adult males treated with ENU This mutation is temperature-sensitive. The mutation is at nucleotide 2325 of the cDNA.; This mutation is a T to C transition. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-041209-2 j20e1 Point Mutation ENU This mutation is a T to C transition. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 2019-09-17
ZDB-ALT-080821-1 j21 Unknown Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped 2019-09-17
ZDB-ALT-070423-3 j23e1 Point Mutation adult males treated with ENU Stephen C. Ekker Laboratory ZDB-LAB-970908-70 Chr: 8 2019-09-17
ZDB-ALT-080706-1 j246 gw246 Small Deletion adult males treated with ENU The point mutation creates a new dominant splice consensus sequence. This results in a 12-bp in-frame deletion (which removes 4 amino acids in the ATPase domain). Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 14 2019-09-17
ZDB-ALT-190812-1 j247 Small Deletion embryos treated with CRISPR Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 16 2019-09-17
ZDB-ALT-070423-4 j24e1 Point Mutation adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 10 2019-09-17
ZDB-ALT-001205-6 j3e1 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 2019-09-17
ZDB-ALT-001205-2 j3e1527 Unknown Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 2019-09-17
ZDB-ALT-001205-10 j3e2 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 2019-09-17
ZDB-ALT-001205-8 j3e3 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 2019-09-17
ZDB-ALT-001205-4 j3e988 Unknown Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 1 2019-09-17
ZDB-ALT-001205-16 j4blue Small Deletion A 5 nucleotide deletion near the middle of the 2nd kinase domain leads to 32 novel amino acids and a premature stop codon. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 14 2019-09-17
ZDB-ALT-001205-14 j4e1 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 14 2019-09-17
ZDB-ALT-001205-12 j4e2 Point Mutation ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 14 2019-09-17
ZDB-ALT-050222-2 j7e1 Cx43-F30V Point Mutation adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-050222-6 j7e2 Cx43-P191S Point Mutation adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-050222-4 j7e3 Cx43-F209I Point Mutation adult males treated with ENU Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 20 2019-09-17
ZDB-ALT-110211-4 j900Tg Tg(Fru.Tyrp1:GFP)j900 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Tru.Tyrp1:GFP) ZDB-TGCONSTRCT-070321-1 2019-09-17
ZDB-ALT-110613-1 j901Tg Tg(CMV:kitlga)j901 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(CMV:kitlga-JRed) ZDB-TGCONSTRCT-110613-1 2019-09-17
ZDB-ALT-130531-3 j933Tg Tg(Xla.Eef1a1:EGFP-rpl10a)j933 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Xla.Eef1a1:EGFP-rpl10a) ZDB-TGCONSTRCT-130531-3 2019-09-17
ZDB-ALT-130531-4 j934Tg Tg(Tru.Tyrp1:EGFP-rpl10a)j934 Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Tru.Tyrp1:EGFP-rpl10a) ZDB-TGCONSTRCT-130531-4 2019-09-17
ZDB-ALT-190715-4 j972Tg Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(hsp70l:gabbr1a,Xla.Ef1a:EGFP) ZDB-TGCONSTRCT-190715-1 2019-09-17
ZDB-ALT-110420-1 j999aTg Tg(Fru.Kit:EGFP)j999a Transgenic Insertion embryos treated with DNA Stephen L. Johnson Lab ZDB-LAB-980202-4 Unmapped Tg(Tru.Kit:EGFP) ZDB-TGCONSTRCT-110420-1 2019-09-17
ZDB-ALT-080812-2 j9e1 Point Mutation Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 17 2019-09-17
ZDB-ALT-080812-3 j9e2 Point Mutation Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 17 2019-09-17
ZDB-ALT-060909-2 j9s1 Point Mutation spontaneous This is a C to T transition, C2275T, which results in a Pro to Ser amino acid change at position 759. Stephen L. Johnson Lab ZDB-LAB-980202-4 Chr: 17 2019-09-17
ZDB-ALT-130314-1 ja101Et Et(T2KHG)ja101, Tol047 Transgenic Insertion embryos treated with DNA Group of Animal Morphogenesis During Development ZDB-LAB-970424-82 Unmapped Et(T2KHG) ZDB-ETCONSTRCT-090611-1 2019-09-17
ZDB-ALT-190110-2 ja102 Small Deletion embryos treated with TALEN1-pih1d1 Group of Animal Morphogenesis During Development ZDB-LAB-970424-82 Chr: 3 2019-09-17
ZDB-ALT-190110-3 ja103 Small Deletion embryos treated with TALEN1-pih1d2 Group of Animal Morphogenesis During Development ZDB-LAB-970424-82 Chr: 15 2019-09-17
ZDB-ALT-190110-4 ja104 Indel embryos treated with CRISPR1-dnaaf2 Group of Animal Morphogenesis During Development ZDB-LAB-970424-82 Chr: 13 2019-09-17
ZDB-ALT-190110-5 ja105 Small Deletion embryos treated with CRISPR1-pih1d3 Group of Animal Morphogenesis During Development ZDB-LAB-970424-82 Chr: 2 2019-09-17
ZDB-ALT-081126-1 ja1Tg Ex(-1055), Tg(-1055exorh:EGFP)zf114, Tg(exorh:EGFP)ja1, zf114 Transgenic Insertion DNA Construct Ex(-1055) was made by ligating the EGFP gene to the 1,055-bp fragment upstream of the exorh translation initiation site. Fukada Lab ZDB-LAB-090113-1 Unmapped Tg(exorh:EGFP) ZDB-TGCONSTRCT-081126-1 2019-09-17
ZDB-ALT-151102-8 ja23Tg Transgenic Insertion embryos treated with DNA Fukada Lab ZDB-LAB-090113-1 Unmapped Tg(gnat2:EGFP) ZDB-TGCONSTRCT-151102-1 2019-09-17
ZDB-ALT-090115-1 ja2Tg Rh(-1084), Tg(rho:EGFP)ja2 Transgenic Insertion embryos treated with DNA Construct contains -1084 bp of rho upstream promoter driving EGFP. Fukada Lab ZDB-LAB-090113-1 Unmapped Tg(rho:EGFP) ZDB-TGCONSTRCT-090115-1 2019-09-17
ZDB-ALT-090115-2 ja3Tg Rh(-1084)/PIPE, rh/PIPE:GFP, Tg(rho-exorh.1:EGFP)ja3 Transgenic Insertion embryos treated with DNA Expresses EGFP under the control of -1084 bp of the zebrafish rhodopsin promoter with one Pineal Expression-Promoting Element (PIPE) repeats from the exorh gene at -184 to -174bp within the rho promoter. Fukada Lab ZDB-LAB-090113-1 Unmapped Tg1(rho-exorh:EGFP) ZDB-TGCONSTRCT-090115-2 2019-09-17
ZDB-ALT-090112-2 ja4Tg Tg(exorh-rho:GFP)zf116, Tg(P20-rh/P:gfp), Tg(rho-exorh.2:EGFP)ja4, zf116 Transgenic Insertion embryos treated with DNA Fukada Lab ZDB-LAB-090113-1 Unmapped Tg2(rho-exorh:EGFP) ZDB-TGCONSTRCT-090112-1 2019-09-17
ZDB-ALT-151102-3 ja51 Indel embryos treated with TALEN1-six7 8bp deletion in exon 1 of six7 Fukada Lab ZDB-LAB-090113-1 Chr: 7 2019-09-17
ZDB-ALT-151102-4 ja52 Small Deletion embryos treated with TALEN1-six7 13bp deletion in exon1 of six7 Fukada Lab ZDB-LAB-090113-1 Chr: 7 2019-09-17
ZDB-ALT-151102-6 ja53 Small Deletion embryos treated with TALEN1-six3b 11bp deletion in exon 1 of six3b Fukada Lab ZDB-LAB-090113-1 Chr: 12 2019-09-17
ZDB-ALT-151102-5 ja54 Indel embryos treated with TALEN1-six7 6 bp deletion. Amino Acid N18 is changed to a stop codon. Fukada Lab ZDB-LAB-090113-1 Chr: 7 2019-09-17
ZDB-ALT-151102-7 ja55 Small Deletion embryos treated with TALEN1-six3b 4bp deletion in exon1 of six3b Fukada Lab ZDB-LAB-090113-1 Chr: 12 2019-09-17
ZDB-ALT-110627-1 ja5Tg GRK7B, Tg(rho:grk7a)ja5 Transgenic Insertion embryos treated with DNA Fukada Lab ZDB-LAB-090113-1 Unmapped Tg(rho:grk7a) ZDB-TGCONSTRCT-110627-1 2019-09-17
ZDB-ALT-110627-2 ja6Tg GRK7D, Tg(rho:grk7a)ja6 Transgenic Insertion embryos treated with DNA Fukada Lab ZDB-LAB-090113-1 Unmapped Tg(rho:grk7a) ZDB-TGCONSTRCT-110627-1 2019-09-17
ZDB-ALT-110627-3 ja7Tg GRK7E, Tg(rho:grk7a)ja7 Transgenic Insertion embryos treated with DNA Fukada Lab ZDB-LAB-090113-1 Unmapped Tg(rho:grk7a) ZDB-TGCONSTRCT-110627-1 2019-09-17
ZDB-ALT-110627-4 ja8Tg GRK1alpha, Tg(rho:grk1a)ja8 Transgenic Insertion embryos treated with DNA Fukada Lab ZDB-LAB-090113-1 Unmapped Tg(rho:grk1a) ZDB-TGCONSTRCT-110627-2 2019-09-17
ZDB-ALT-110627-5 ja9Tg GRK1beta, Tg(rho:grk1a)ja9 Transgenic Insertion embryos treated with DNA Fukada Lab ZDB-LAB-090113-1 Unmapped Tg(rho:grk1a) ZDB-TGCONSTRCT-110627-2 2019-09-17
ZDB-ALT-160519-1 jf10Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:ReaChR-TagRFPT) ZDB-TGCONSTRCT-160519-1 2019-09-17
ZDB-ALT-160519-2 jf14Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:H2B-MKATE2) ZDB-TGCONSTRCT-160519-2 2019-09-17
ZDB-ALT-160519-3 jf16Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:jRCaMP1a) ZDB-TGCONSTRCT-160519-3 2019-09-17
ZDB-ALT-150916-3 jf1Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:GCaMP6f) ZDB-TGCONSTRCT-150916-3 2019-09-17
ZDB-ALT-170125-1 jf41Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(tph2:epNTR-TagRFPT) ZDB-TGCONSTRCT-170125-1 2019-09-17
ZDB-ALT-180920-4 jf42Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(10xUAS:Voltron) ZDB-TGCONSTRCT-190123-6 2019-09-17
ZDB-ALT-141023-1 jf4Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:GCaMP6s) ZDB-TGCONSTRCT-141023-2 2019-09-17
ZDB-ALT-141023-2 jf5Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:Hsa.H2B-GCaMP6s) ZDB-TGCONSTRCT-141023-1 2019-09-17
ZDB-ALT-150916-4 jf7Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:H2B-GCaMP6f) ZDB-TGCONSTRCT-150916-4 2019-09-17
ZDB-ALT-180410-5 jf92Tg Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:CaMPARI2) ZDB-TGCONSTRCT-180410-1 2019-09-17
ZDB-ALT-150403-1 jf9Tg Tg[elavl3:CaMPARI(W391F+V398L)]jf9 Transgenic Insertion embryos treated with DNA Ahrens Lab ZDB-LAB-130116-1 Unmapped Tg(elavl3:CaMPARI) ZDB-TGCONSTRCT-150403-1 2019-09-17
ZDB-ALT-110131-24 jh100Tg Tg(Mmu.Sox10.1:EGFP)jh100 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg1(Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-32 2019-09-17
ZDB-ALT-110131-25 jh101Tg Tg(Mmu.Sox10.1B:EGFP)jh101 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(Mmu.Sox10.1B:EGFP) ZDB-TGCONSTRCT-110131-33 2019-09-17
ZDB-ALT-110131-26 jh102Tg Tg(Mmu.Sox10.1C:EGFP)jh102 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(Mmu.Sox10.1C:EGFP) ZDB-TGCONSTRCT-110131-34 2019-09-17
ZDB-ALT-110131-27 jh103Tg Tg(-1.2Mmu.Sox10:EGFP)jh103 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-1.2Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-24 2019-09-17
ZDB-ALT-110131-28 jh104Tg Tg(-9.5Mmu.Sox10:EGFP)jh104 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-9.5Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-25 2019-09-17
ZDB-ALT-110131-29 jh105Tg Tg(-28.5Mmu.Sox10:EGFP)jh105 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-28.5Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-26 2019-09-17
ZDB-ALT-110131-30 jh106Tg Tg(-37.2Mmu.Sox10:EGFP)jh106 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-37.2Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-27 2019-09-17
ZDB-ALT-110131-31 jh107Tg Tg(-43.3Mmu.Sox10:EGFP)jh107 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-43.3Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-28 2019-09-17
ZDB-ALT-110131-32 jh108Tg Tg(-48.5Mmu.Sox10:EGFP)jh108 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-48.5Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-29 2019-09-17
ZDB-ALT-110131-33 jh109Tg Tg(-55.1Mmu.Sox10:EGFP)jh109 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-55.1Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-30 2019-09-17
ZDB-ALT-110221-1 jh10Tg Tg(ins:hmgb1-EGFP)jh10 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ins:hmgb1-EGFP) ZDB-TGCONSTRCT-110221-1 2019-09-17
ZDB-ALT-110131-34 jh110Tg Tg(-59.1Mmu.Sox10:EGFP)jh110 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-59.1Mmu.Sox10:EGFP) ZDB-TGCONSTRCT-110131-31 2019-09-17
ZDB-ALT-110819-1 jh112Tg Tg(Hsa.ERBB3.1:EGFP)jh112 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg1(Hsa.ERBB3:EGFP) ZDB-TGCONSTRCT-110819-1 2019-09-17
ZDB-ALT-110819-2 jh113Tg Tg(Hsa.ERBB3.2:EGFP)jh113 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg2(Hsa.ERBB3:EGFP) ZDB-TGCONSTRCT-110819-2 2019-09-17
ZDB-ALT-110819-3 jh114Tg Tg(Hsa.ERBB3.3:EGFP)jh114 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg3(Hsa.ERBB3:EGFP) ZDB-TGCONSTRCT-110819-3 2019-09-17
ZDB-ALT-111013-2 jh115Tg 46, Tg(-7.3Hsa.ASCL1:EGFP)jh115 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-7.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111012-8 2019-09-17
ZDB-ALT-111013-3 jh116Tg 54, Tg(-6.1Hsa.ASCL1:EGFP)jh116 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-6.1Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-1 2019-09-17
ZDB-ALT-111013-4 jh117Tg 33, Tg(-6.1Hsa.ASCL1:EGFP)jh117 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-6.1Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-1 2019-09-17
ZDB-ALT-111013-5 jh118Tg 67, Tg(-6.1Hsa.ASCL1:EGFP)jh118 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-6.1Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-1 2019-09-17
ZDB-ALT-111013-6 jh119Tg 50, Tg(-6.1Hsa.ASCL1:EGFP)jh119 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-6.1Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-1 2019-09-17
ZDB-ALT-101006-1 jh11Tg Tg(EPV.Tp1-Ocu.Hbb2:hmgb1-mCherry)jh11, THM-9 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(EPV.Tp1-Ocu.Hbb2:hmgb1-mCherry) ZDB-TGCONSTRCT-101006-1 2019-09-17
ZDB-ALT-111013-7 jh120Tg 36, Tg(-1.4Hsa.ASCL1:EGFP)jh120 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-1.4Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-2 2019-09-17
ZDB-ALT-111013-8 jh121Tg 39, Tg(-1.4Hsa.ASCL1:EGFP)jh121 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-1.4Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-2 2019-09-17
ZDB-ALT-111013-9 jh122Tg 7, Tg(3.3Hsa.ASCL1:EGFP)jh122 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(3.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-3 2019-09-17
ZDB-ALT-111013-10 jh123Tg 9, Tg(3.3Hsa.ASCL1:EGFP)jh123 Transgenic Insertion adult males treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(3.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-3 2019-09-17
ZDB-ALT-111013-11 jh124Tg 10, Tg(3.3Hsa.ASCL1:EGFP)jh124 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(3.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-3 2019-09-17
ZDB-ALT-111013-12 jh125Tg 23, Tg(3.3Hsa.ASCL1:EGFP)jh125 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(3.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-3 2019-09-17
ZDB-ALT-111013-13 jh126Tg 68, Tg(3.3Hsa.ASCL1:EGFP;phox2bb:EGFP)jh126 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(3.3Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-3, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-14 jh127Tg 30, Tg(3.3Hsa.ASCL1:EGFP;phox2bb:EGFP)jh127 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(3.3Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-3, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-15 jh128Tg 53, Tg(Hsa.ASCL1.5:EGFP)jh128 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(13.2Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-5 2019-09-17
ZDB-ALT-111013-16 jh129Tg 19, Tg(Hsa.ASCL1.5:EGFP;phox2bb:EGFP)jh129 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(13.2Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-5, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-110221-2 jh12Tg Tg(EPV.Tp1-Ocu.Hbb2:CreERT2)jh12 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(EPV.Tp1-Ocu.Hbb2:Cre-ERT2) ZDB-TGCONSTRCT-110221-2 2019-09-17
ZDB-ALT-111013-17 jh130Tg 80, Tg(Hsa.ASCL1.5:EGFP;phox2bb:EGFP)jh130 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(13.2Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-5, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-18 jh131Tg 59, Tg(Hsa.ASCL1.5:EGFP;phox2bb:EGFP)jh131 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(13.2Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-5, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-19 jh132Tg 40, Tg(-7.3Hsa.ASCL1:EGFP;3.3Hsa.ASCL1:EGFP)jh132 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-7.3Hsa.ASCL1:EGFP), Tg(3.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111012-8, ZDB-TGCONSTRCT-111013-3 2019-09-17
ZDB-ALT-111013-21 jh133Tg 43, Tg(-7.3Hsa.ASCL1:EGFP;3.3Hsa.ASCL1:EGFP;phox2bb:EGFP)jh133 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-7.3Hsa.ASCL1:EGFP), Tg(3.3Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111012-8, ZDB-TGCONSTRCT-111013-3, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-20 jh134Tg 63, Tg(7Hsa.ASCL1:EGFP;3.3Hsa.ASCL1:EGFP)jh134 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(3.3Hsa.ASCL1:EGFP), Tg(7.0Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-3, ZDB-TGCONSTRCT-160325-2 2019-09-17
ZDB-ALT-111013-22 jh135Tg 60, Tg(-7.3Hsa.ASCL1:EGFP;13.2Hsa.ASCL1:EGFP)jh135 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(13.2Hsa.ASCL1:EGFP), Tg(3.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-5, ZDB-TGCONSTRCT-111013-3 2019-09-17
ZDB-ALT-111013-23 jh136Tg 51, Tg(-6.1Hsa.ASCL1:EGFP;13.2Hsa.ASCL1:EGFP;phox2bb:EGFP)jh136 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-6.1Hsa.ASCL1:EGFP), Tg(13.2Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-1, ZDB-TGCONSTRCT-111013-5, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-24 jh137Tg 1, Tg(-6.1Hsa.ASCL1:EGFP;-1.4Hsa.ASCL1:EGFP)jh137 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-1.4Hsa.ASCL1:EGFP), Tg(-6.1Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-2, ZDB-TGCONSTRCT-111013-1 2019-09-17
ZDB-ALT-111013-25 jh138Tg 58, Tg(3.3Hsa.ASCL1:EGFP;13.2Hsa.ASCL1:EGFP)jh138 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(13.2Hsa.ASCL1:EGFP), Tg(3.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-5, ZDB-TGCONSTRCT-111013-3 2019-09-17
ZDB-ALT-111013-26 jh139Tg 15, Tg(-1.4Hsa.ASCL1:EGFP;7Hsa.ASCL1:EGFP;13.2Hsa.ASCL1:EGFP)jh139 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-1.4Hsa.ASCL1:EGFP), Tg(13.2Hsa.ASCL1:EGFP), Tg(7.0Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-2, ZDB-TGCONSTRCT-111013-5, ZDB-TGCONSTRCT-160325-2 2019-09-17
ZDB-ALT-111013-27 jh140Tg 16, Tg(-7.3Hsa.ASCL1:EGFP;3.3Hsa.ASCL1:EGFP;7Hsa.ASCL1:EGFP)jh140 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-7.3Hsa.ASCL1:EGFP), Tg(3.3Hsa.ASCL1:EGFP), Tg(7.0Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111012-8, ZDB-TGCONSTRCT-111013-3, ZDB-TGCONSTRCT-160325-2 2019-09-17
ZDB-ALT-111013-28 jh141Tg 22, Tg(-7.3Hsa.ASCL1:EGFP;-6.1Hsa.ASCL1:EGFP;-1.4Hsa.ASCL1:EGFP)jh141 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-1.4Hsa.ASCL1:EGFP), Tg(-6.1Hsa.ASCL1:EGFP), Tg(-7.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-2, ZDB-TGCONSTRCT-111013-1, ZDB-TGCONSTRCT-111012-8 2019-09-17
ZDB-ALT-111013-29 jh142Tg 66, Tg(-1.4Hsa.ASCL1:EGFP;3.3Hsa.ASCL1:EGFP;phox2bb:EGFP)jh142 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-1.4Hsa.ASCL1:EGFP), Tg(3.3Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-2, ZDB-TGCONSTRCT-111013-3, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-30 jh143Tg 69, Tg(Hsa.ASCL1.1:EGFP;Hsa.ASCL1.2:EGFP;Hsa.ASCL1.3:EGFP;Hsa.ASjh143 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-1.4Hsa.ASCL1:EGFP), Tg(-6.1Hsa.ASCL1:EGFP), Tg(-7.3Hsa.ASCL1:EGFP), Tg(54.4Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-2, ZDB-TGCONSTRCT-111013-1, ZDB-TGCONSTRCT-111012-8, ZDB-TGCONSTRCT-111013-18 2019-09-17
ZDB-ALT-111013-31 jh144Tg 70, Tg(-6.1Hsa.ASCL1:EGFP;7Hsa.ASCL1:EGFP;13.2Hsa.ASCL1:EGFP)jh144 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-6.1Hsa.ASCL1:EGFP), Tg(13.2Hsa.ASCL1:EGFP), Tg(7.0Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111013-1, ZDB-TGCONSTRCT-111013-5, ZDB-TGCONSTRCT-160325-2 2019-09-17
ZDB-ALT-111013-32 jh145Tg 74, Tg(-6.1Hsa.ASCL1:EGFP;phox2bb:EGFP)jh145 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-6.1Hsa.ASCL1:EGFP), Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-1, ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-33 jh146Tg 73, Tg(-7.3Hsa.ASCL1:EGFP;3.3Hsa.ASCL1:EGFP)jh146 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(-7.3Hsa.ASCL1:EGFP), Tg(3.3Hsa.ASCL1:EGFP) ZDB-TGCONSTRCT-111012-8, ZDB-TGCONSTRCT-111013-3 2019-09-17
ZDB-ALT-111013-34 jh147Tg 26, Tg(phox2bb:EGFP)jh147 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-35 jh148Tg 56, Tg(phox2bb:EGFP)jh148 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-36 jh149Tg 62, Tg(phox2bb:EGFP)jh149 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111013-37 jh150Tg 79, Tg(phox2bb:EGFP)jh150 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(phox2bb:EGFP) ZDB-TGCONSTRCT-111013-21 2019-09-17
ZDB-ALT-111012-4 jh151Tg Tg(Hsa.MPZ:EGFP)jh151 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(Hsa.MPZ:EGFP) ZDB-TGCONSTRCT-111012-7 2019-09-17
ZDB-ALT-111012-5 jh152Tg Tg(Hsa.MPZ:EGFP)jh152 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(Hsa.MPZ_1026T>A:EGFP) ZDB-TGCONSTRCT-111021-1 2019-09-17
ZDB-ALT-111012-3 jh153Tg Tg(Hsa.RET:EGFP)jh153 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg(Hsa.RET:EGFP) ZDB-TGCONSTRCT-111012-6 2019-09-17
ZDB-ALT-131211-4 jh154Tg Tg1(Hsa.LMX1A-Mmu.Fos:EGFP)jh154 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg1(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-2 2019-09-17
ZDB-ALT-131211-5 jh155Tg Tg2(Hsa.LMX1A-Mmu.Fos:EGFP)jh155 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg2(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-3 2019-09-17
ZDB-ALT-131211-6 jh156Tg Tg3(Hsa.LMX1A-Mmu.Fos:EGFP)jh156 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg3(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-4 2019-09-17
ZDB-ALT-131211-7 jh157Tg Tg4(Hsa.LMX1A-Mmu.Fos:EGFP)jh157 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg4(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-5 2019-09-17
ZDB-ALT-131211-8 jh158Tg Tg5(Hsa.LMX1A-Mmu.Fos:EGFP)jh158 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg5(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-6 2019-09-17
ZDB-ALT-131211-9 jh159Tg Tg6(Hsa.LMX1A-Mmu.Fos:EGFP)jh159 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg6(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-7 2019-09-17
ZDB-ALT-110221-4 jh15Tg Tg(bactin2:loxP-STOP-loxP-hmgb1-mCherry)jh15 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(actb2:LOXP-STOP-LOXP-hmgb1-mCherry) ZDB-TGCONSTRCT-110221-4 2019-09-17
ZDB-ALT-131211-10 jh160Tg Tg7(Hsa.LMX1A-Mmu.Fos:EGFP)jh160 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg7(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-8 2019-09-17
ZDB-ALT-131211-11 jh161Tg Tg8(Hsa.LMX1A-Mmu.Fos:EGFP)jjh161 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg8(Hsa.LMX1A-Mmu.Fos:EGFP)j ZDB-TGCONSTRCT-131211-9 2019-09-17
ZDB-ALT-131211-12 jh162Tg Tg9(Hsa.LMX1A-Mmu.Fos:EGFP)jh162 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg9(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-10 2019-09-17
ZDB-ALT-131211-13 jh163Tg Tg10(Hsa.LMX1A-Mmu.Fos:EGFP)jh163 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg10(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-11 2019-09-17
ZDB-ALT-131211-14 jh164Tg Tg11(Hsa.LMX1A-Mmu.Fos:EGFP)jh164 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg11(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-12 2019-09-17
ZDB-ALT-131211-15 jh165Tg Tg12(Hsa.LMX1A-Mmu.Fos:EGFP)jh165 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg12(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-13 2019-09-17
ZDB-ALT-131211-16 jh166Tg Tg13(Hsa.LMX1A-Mmu.Fos:EGFP)jh166 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg13(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-14 2019-09-17
ZDB-ALT-131211-17 jh167Tg Tg14(Hsa.LMX1A-Mmu.Fos:EGFP)jh167 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg14(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-15 2019-09-17
ZDB-ALT-131211-18 jh168Tg Tg15(Hsa.LMX1A-Mmu.Fos:EGFP)jh168 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg15(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-16 2019-09-17
ZDB-ALT-131211-19 jh169Tg Tg16(Hsa.LMX1A-Mmu.Fos:EGFP)jh169 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg16(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-17 2019-09-17
ZDB-ALT-100929-1 jh16Tg Tg(ptf1a:Gal4-VP16)jh16 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped TgBAC(ptf1a:GAL4-VP16) ZDB-TGCONSTRCT-100928-5 2019-09-17
ZDB-ALT-131211-20 jh170Tg Tg17(Hsa.LMX1A-Mmu.Fos:EGFP)jh170 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg17(Hsa.LMX1A-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-18 2019-09-17
ZDB-ALT-131211-21 jh171Tg Tg1(Hsa.LMX1B-Mmu.Fos:EGFP)jh171 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg1(Hsa.LMX1B-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-19 2019-09-17
ZDB-ALT-131211-22 jh172Tg Tg2(Hsa.LMX1B-Mmu.Fos:EGFP)jh172 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg2(Hsa.LMX1B-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-20 2019-09-17
ZDB-ALT-131211-23 jh173Tg Tg3(Hsa.LMX1B-Mmu.Fos:EGFP)jh173 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg3(Hsa.LMX1B-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-21 2019-09-17
ZDB-ALT-131211-24 jh174Tg Tg4(Hsa.LMX1B-Mmu.Fos:EGFP)jh174 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg4(Hsa.LMX1B-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-22 2019-09-17
ZDB-ALT-131211-25 jh175Tg Tg5(Hsa.LMX1B-Mmu.Fos:EGFP)jh175 Transgenic Insertion embryos treated with DNA McCallion Lab ZDB-LAB-061018-1 Unmapped Tg5(Hsa.LMX1B-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-131211-23 2019-09-17
ZDB-ALT-110222-4 jh17Tg Tg(UAS-E1b:NfsB-mCherry)jh17 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(UAS-E1B:NTR-mCherry) ZDB-TGCONSTRCT-070314-2 2019-09-17
ZDB-ALT-070531-2 jh1Tg Tg(ptf1a:eGFP)jh1 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ptf1a:EGFP) ZDB-TGCONSTRCT-070531-1 2019-09-17
ZDB-ALT-110221-3 jh20Tg Tg(-2.5sst:EGFP)jh20 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(-2.5sst2:EGFP) ZDB-TGCONSTRCT-110221-3 2019-09-17
ZDB-ALT-110221-5 jh29Tg Tg(bactin2:GFP-CreERT2)jh29 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(actb2:GFP-Cre-ERT2) ZDB-TGCONSTRCT-110221-5 2019-09-17
ZDB-ALT-070124-1 jh2Tg Tg(ins:mCherry)jh2 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ins:mCherry) ZDB-TGCONSTRCT-070124-2 2019-09-17
ZDB-ALT-161221-1 jh32Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(EPV.Tp1-Ocu.Hbb2:hmgb1-mCherry) ZDB-TGCONSTRCT-101006-1 2019-09-17
ZDB-ALT-151007-32 jh33Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ins:PhiYFP,Eco.NfsB,sst2:CFP) ZDB-TGCONSTRCT-151007-28 2019-09-17
ZDB-ALT-170914-1 jh38Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(actb2:LOXP-hmgb1a-ECFP-LOXP-zgc:114046-mCherry) ZDB-TGCONSTRCT-170914-2 2019-09-17
ZDB-ALT-150106-1 jh39Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:LOXP-ECFP-LOXP-dnraraa-EGFP) ZDB-TGCONSTRCT-150106-1 2019-09-17
ZDB-ALT-070606-1 jh3Tg Tg(ins:eGFP)jh3, Tg(ins:EGFP)jh3 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg1(ins:EGFP) ZDB-TGCONSTRCT-070606-1 2019-09-17
ZDB-ALT-161121-2 jh47Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:LOXP-ECFP-LOXP-sox9b-2A-mCherry) ZDB-TGCONSTRCT-161121-3 2019-09-17
ZDB-ALT-161121-3 jh48Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:LOXP-ECFP-LOXP-dnsox9b-2A-mCherry) ZDB-TGCONSTRCT-161121-4 2019-09-17
ZDB-ALT-140722-6 jh49Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(fabp10a:QF,crybb1:ECFP) ZDB-TGCONSTRCT-140721-4 2019-09-17
ZDB-ALT-070606-2 jh4Tg Tg(ins:nfsB-mcherry)jh4, Tg(ins:nfsB-mCherry)jh4 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ins:NTR-mCherry) ZDB-TGCONSTRCT-070606-2 2019-09-17
ZDB-ALT-140722-5 jh50Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ins:QF,crybb1:ECFP) ZDB-TGCONSTRCT-140721-5 2019-09-17
ZDB-ALT-140722-4 jh51Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(EPV.Tp1:QF,crybb1:ECFP) ZDB-TGCONSTRCT-140721-6 2019-09-17
ZDB-ALT-150106-3 jh55Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(RARE:QF,QUAS:GFP) ZDB-TGCONSTRCT-150106-2 2019-09-17
ZDB-ALT-140721-1 jh58Tg jhjh58Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:Dre-PBD,cryaa:ECFP) ZDB-TGCONSTRCT-140721-1 2019-09-17
ZDB-ALT-140718-1 jh59Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:Dre,cryaa:Venus) ZDB-TGCONSTRCT-140718-1 2019-09-17
ZDB-ALT-070606-3 jh5Tg Tg(ins:nfsB-mcherry)jh5, Tg(ins:nfsB-mCherry)jh5 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ins:NTR-mCherry) ZDB-TGCONSTRCT-070606-2 2019-09-17
ZDB-ALT-140718-2 jh60Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:ROX-NLS-mCherry-ROX-EGFP) ZDB-TGCONSTRCT-140718-2 2019-09-17
ZDB-ALT-140718-3 jh61Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:loxa-STOP-loxa-ROX-NLS-mCherry-STOP-ROX-EGFP,cryaa:mCherry) ZDB-TGCONSTRCT-140718-3 2019-09-17
ZDB-ALT-140722-7 jh62Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:Cre,cryaa:Venus) ZDB-TGCONSTRCT-140722-2 2019-09-17
ZDB-ALT-151007-31 jh63Tg Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ubb:LOXP-CFP-LOXP-zgc:114046-mCherry) ZDB-TGCONSTRCT-151007-29 2019-09-17
ZDB-ALT-070606-4 jh6Tg Tg(ins:kaede)jh6 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ins:Kaede) ZDB-TGCONSTRCT-070606-3 2019-09-17
ZDB-ALT-081021-1 jh7Tg Tg(ptf1a:eGFP-KRAS_G12V)jh7, Tg(ptf1a:EGFP-KRAS_G12V)jh7 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(ptf1a:EGFP-Hsa.KRAS_G12V) ZDB-TGCONSTRCT-081021-2 2019-09-17
ZDB-ALT-080214-3 jh8Tg Tg(T2Kins:EGFP-mCherry)jh8, Tg(T2Kins:EGFP-mCherry)zf75, zf75 Transgenic Insertion embryos treated with DNA Parsons Lab ZDB-LAB-060130-1 Unmapped Tg(T2Kins:EGFP-mCherry) ZDB-TGCONSTRCT-080214-2 2019-09-17
ZDB-ALT-070426-2 jj108 Unknown adult males treated with ENU overall ear morphology severely reduced, fused otoliths, and lack of semicircular canals. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-6 jj149 Unknown adult males treated with ENU No otoliths present. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-020325-2 jj2 Translocation sperm treated with g-rays Malicki Lab ZDB-LAB-990303-4 Chr: 17 2019-09-17
ZDB-ALT-120327-1 jj203 Point Mutation adult males treated with ENU Malicki Lab ZDB-LAB-990303-4 Chr: 23 2019-09-17
ZDB-ALT-170126-3 jj263 Point Mutation adult males treated with ENU Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-9 jj273 Unknown adult males treated with ENU Otolith size is reduced. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-12 jj290 fos Unknown adult males treated with ENU Otic vesicle size reduced. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-13 jj291 fos Unknown adult males treated with ENU Otic vesicle size reduced. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-5 jj301 Unknown adult males treated with ENU Otic vesicle size reduced and missing one otolith. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-2 jj354 Unknown adult males treated with ENU Otic capsule bulges out. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-3 jj386 Unknown adult males treated with ENU Ear rounder and bulges out, slightly reduced ear size. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-11 jj392 Unknown adult males treated with ENU Ear size severely reduced, dorsal portion of the ear reduced, and fused maculae. Malicki Lab ZDB-LAB-990303-4 Ambiguous 2019-09-17
ZDB-ALT-070426-3 jj410 ale ucho Point Mutation adult males treated with ENU Mutation in lmx1b (ENSDARG00000068365) that introduces a premature termination codon at 34,129,111 (T>A) on chromosome 8. Overall ear size reduced, abnormally formed semicircular canals, and slightly reduced otoliths. Malicki Lab ZDB-LAB-990303-4 Chr: 8 2019-09-17
ZDB-ALT-070427-4 jj433 Unknown adult males treated with ENU Smaller and flattened otic vesicle. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-10 jj465 Unknown adult males treated with ENU Ear size and otolith size slightly reduced. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-090805-1 jj50 ale oko Point Mutation ENU The mutation results in a cryptic splice site, which leads to a 9-bp insertion at the RNA level. Homozygous lethal at 7 days. Phenotype includes small eye size, photoreceptor and hair cell degeneration. Loss of p50 function in dynactin complex. Malicki Lab ZDB-LAB-990303-4 Chr: 6 2019-09-17
ZDB-ALT-070427-1 jj59 hako mimi Point Mutation adult males treated with ENU G>A mutation at position 35,593,144 on chromosome 13 in jag1b (ENSDARG00000013168) disrupting a splice donor site resulting in a frameshift. Antero-posterior axis is shortened in the ear. Malicki Lab ZDB-LAB-990303-4 Chr: 13 2019-09-17
ZDB-ALT-070427-7 jj61 Unknown adult males treated with ENU Otoliths display an irregular shape, frequently only the posterior otolith is present. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-070427-8 jj78 Unknown adult males treated with ENU Otolith size severly reduced. Malicki Lab ZDB-LAB-990303-4 Unmapped 2019-09-17
ZDB-ALT-080731-1 jk65 Point Mutation ENU A. Kawakami Lab ZDB-LAB-001121-1 Chr: 7 2019-09-17
ZDB-ALT-131031-1 js101Tg Transgenic Insertion DNA Ogura Lab ZDB-LAB-131029-1 Unmapped Et(hsp70l:GAL4FF) ZDB-ETCONSTRCT-080529-1 2019-09-17
ZDB-ALT-060705-4 js12Tg js12, Tg(nrp1a:GFP), Tg(nrp1a:GFP)js12 Transgenic Insertion embryos treated with DNA Shoji Lab ZDB-LAB-030714-2 Unmapped Tg(nrp1a:GFP) ZDB-TGCONSTRCT-070117-109 2019-09-17
ZDB-ALT-030716-4 js18Tg js18, Tg(hsp70l:gfp-sema3aa-myc), Tg(hsp70l:gfp-sema3aa-myc)js18 Transgenic Insertion embryos treated with DNA Shoji Lab ZDB-LAB-030714-2 Unmapped Tg(hsp70l:EGFP-sema3aa-6xMYC) ZDB-TGCONSTRCT-070117-159 2019-09-17
ZDB-ALT-150311-4 js201 Small Deletion embryos treated with TALEN1-rspo2 Tatsumi (et al) 2014: An 8-bp deletion mutation in the region encoding the signal\nsequence of rspo2. Deletion led to a frame shift that produced a stop codon after 23 aa and was expected to be a null-type mutation without any functional domains Ogura Lab ZDB-LAB-131029-1 Chr: 16 2019-09-17
ZDB-ALT-150311-5 js202 Small Deletion embryos treated with TALEN2-rspo2 Tatsumi et al (2014): A 7-bp deletion mutation located near the start of region encoding the rspo2 thrombospondin domain; a frame shift produced a stop codon after 21 aa, and the resulting truncated protein lacked the thrombospondin and basic domains, while retaining the signal peptide and two furin-like domains. Ogura Lab ZDB-LAB-131029-1 Chr: 16 2019-09-17
ZDB-ALT-150511-1 js203Tg Transgenic Insertion embryos treated with DNA Suzuki Lab ZDB-LAB-150310-1 Unmapped Tg(Tru.Pou5f3:EGFP) ZDB-TGCONSTRCT-150511-1 2019-09-17
ZDB-ALT-030716-6 js39Tg js39, Tg(hsp70l:gfp-sema3aa-myc), Tg(hsp70l:gfp-sema3aa-myc)js39 Transgenic Insertion embryos treated with DNA Shoji Lab ZDB-LAB-030714-2 Unmapped Tg(hsp70l:EGFP-sema3aa-6xMYC) ZDB-TGCONSTRCT-070117-159 2019-09-17
ZDB-ALT-130624-1 js3Tg Tg(UAS:Cr.ChR-EGFP)js3 Transgenic Insertion embryos treated with DNA Shoji Lab ZDB-LAB-030714-2 Unmapped Tg(UAS:ChRWR-EGFP) ZDB-TGCONSTRCT-130624-1 2019-09-17
ZDB-ALT-060705-2 js8Tg js8, Tg(nrp1a:GFP), Tg(nrp1a:GFP)js8 Transgenic Insertion embryos treated with DNA Shoji Lab ZDB-LAB-030714-2 Unmapped Tg(nrp1a:GFP) ZDB-TGCONSTRCT-070117-109 2019-09-17
ZDB-ALT-080409-4 jt0012Tg Tg(omp:tau-EGFP)jt0012, Tg(omp:tauEGFP)jt0012 Transgenic Insertion embryos treated with DNA Mishina Lab ZDB-LAB-980217-6 Unmapped Tg(ompb:tau-EGFP) ZDB-TGCONSTRCT-080409-4 2019-09-17
ZDB-ALT-080409-3 jt0021Tg Tg(chrnb3b:EGFP)jt0021 Transgenic Insertion embryos treated with DNA Mishina Lab ZDB-LAB-980217-6 Unmapped Tg(chrnb3b:EGFP) ZDB-TGCONSTRCT-080409-3 2019-09-17
ZDB-ALT-051114-4 jt0031Tg jt1, Tg(tbr1:EYFP), Tg(tbr1:EYFP)jt0031, Tg(tbr1:EYFP)jt1, Tg(tbr1:EYFP)unspecified Transgenic Insertion embryos treated with DNA Mishina Lab ZDB-LAB-980217-6 Unmapped Tg(tbr1:EYFP) ZDB-TGCONSTRCT-070117-115 2019-09-17
ZDB-ALT-111111-1 jt0041Tg Tg(ompb:Rno.Vamp2-ECFP)jt0041 Transgenic Insertion embryos treated with DNA Mishina Lab ZDB-LAB-980217-6 Unmapped Tg(ompb:Rno.Vamp2-ECFP) ZDB-TGCONSTRCT-111111-2 2019-09-17
ZDB-ALT-111111-2 jt0051Tg Tg(ompb:Rno.Vamp2-EGFP,ompb:ptprsa_C1556S)jt0051 Transgenic Insertion embryos treated with DNA Mishina Lab ZDB-LAB-980217-6 Unmapped Tg(ompb:Rno.Vamp2-EGFP,ompb:ptprsa_C1556S) ZDB-TGCONSTRCT-111111-1 2019-09-17
ZDB-ALT-111111-3 jt0052Tg Tg(ompb:Rno.Vamp2-EGFP,ompb:ptprsa_C1556S)jt0052 Transgenic Insertion embryos treated with DNA Mishina Lab ZDB-LAB-980217-6 Unmapped Tg(ompb:Rno.Vamp2-EGFP,ompb:ptprsa_C1556S) ZDB-TGCONSTRCT-111111-1 2019-09-17
ZDB-ALT-111111-4 jt0053Tg Tg(ompb:Rno.Vamp2-EGFP,ompb:ptprsa_C1556S)jt0053 Transgenic Insertion embryos treated with DNA Mishina Lab ZDB-LAB-980217-6 Unmapped Tg(ompb:Rno.Vamp2-EGFP,ompb:ptprsa_C1556S) ZDB-TGCONSTRCT-111111-1 2019-09-17
ZDB-ALT-171018-3 jt1 FIP200-/- Small Deletion embryos treated with CRISPR1-rb1cc1 Mizushima Lab ZDB-LAB-170117-1 Chr: 24 2019-09-17
ZDB-ALT-010410-2 jt10 j10 Unknown sperm treated with TMP Mishina Lab ZDB-LAB-980217-6 Unmapped 2019-09-17
ZDB-ALT-020621-2 jt12 Unknown Mishina Lab ZDB-LAB-980217-6 Chr: 9 2019-09-17
ZDB-ALT-171018-4 jt2Tg Transgenic Insertion embryos treated with DNA Mizushima Lab ZDB-LAB-170117-1 Unmapped Tg(Xla.Eef1a1:GFP-Rno.Map1lc3b,mRFP-Rno.Map1lc3bDeltaG) ZDB-TGCONSTRCT-171018-1 2019-09-17
ZDB-ALT-010410-4 jt5 j5 Small Deletion TMP Matsuda and Mishina (2004) report a 143 bp deletion in the cct3 transcript from jt5 fish. The cct3 transcript in the mutant
embryos completely lacked a putative ATPase motif and the reading frame was shifted. Mishina Lab ZDB-LAB-980217-6 Chr: 16 2019-09-17
ZDB-ALT-170801-12 ka101Tg Transgenic Insertion embryos treated with DNA Grabher Lab ZDB-LAB-091130-2 Unmapped Tg(mpeg1.1:GFP) ZDB-TGCONSTRCT-170801-5 2019-09-17
ZDB-ALT-170801-13 ka108Tg Transgenic Insertion embryos treated with DNA Grabher Lab ZDB-LAB-091130-2 Unmapped Tg(actb2:Hsa.GLRX-roGFP,myl7:GFP) ZDB-TGCONSTRCT-170801-6 2019-09-17
ZDB-ALT-170801-14 ka109Tg Transgenic Insertion embryos treated with DNA Grabher Lab ZDB-LAB-091130-2 Unmapped Tg(npsn:GFP) ZDB-TGCONSTRCT-170801-7 2019-09-17
ZDB-ALT-170801-15 ka110Tg Transgenic Insertion embryos treated with DNA Grabher Lab ZDB-LAB-091130-2 Unmapped Tg(actb2:roGFP-Sce.HYR1,myl7:GFP) ZDB-TGCONSTRCT-170801-8 2019-09-17
ZDB-ALT-130516-2 ka13aTg Tg(4xEBOX:Luciferase)ka13a Transgenic Insertion embryos treated with DNA Dickmeis Lab ZDB-LAB-090423-1 Unmapped Tg(4xEBOX:Luciferase) ZDB-TGCONSTRCT-130516-2 2019-09-17
ZDB-ALT-130516-3 ka13bTg Tg(4xEBOX:Luciferase)ka13b Transgenic Insertion embryos treated with DNA Dickmeis Lab ZDB-LAB-090423-1 Unmapped Tg(4xEBOX:Luciferase) ZDB-TGCONSTRCT-130516-2 2019-09-17
ZDB-ALT-160322-1 ka14Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(-1.8unc45b:TFP) ZDB-TGCONSTRCT-160322-1 2019-09-17
ZDB-ALT-160322-2 ka15Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(unc45b-gata2a:EGFP) ZDB-TGCONSTRCT-160322-2 2019-09-17
ZDB-ALT-090129-1 ka1Tg Tg(-2.4shha-M12:GFP)ka1 Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(-2.4shha-M12:GFP) ZDB-TGCONSTRCT-090129-1 2019-09-17
ZDB-ALT-121031-3 ka201Tg Tg(UAS:Hsa.HIST2H2BE-CFP,Hsa.HRAS_G12V)ka201 Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Tg(UAS:Hsa.HIST2H2BE-CFP,Hsa.HRAS_G12V) ZDB-TGCONSTRCT-121031-3 2019-09-17
ZDB-ALT-190626-1 ka202Tg Transgenic Insertion embryos treated with DNA Mione Lab ZDB-LAB-050531-2 Unmapped Tg(5xUAS:EGFP-jmjd6,myl7:EGFP) ZDB-TGCONSTRCT-190626-2 2019-09-17
ZDB-ALT-090129-2 ka2Tg Tg(-2.4shha-M13:GFP)ka2 Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(-2.4shha-M13:GFP) ZDB-TGCONSTRCT-090129-2 2019-09-17
ZDB-ALT-130125-1 ka300Tg Tg(-2.4shha-ABC:DsRed)ka300 Transgenic Insertion embryos treated with DNA Scholpp Lab ZDB-LAB-080129-1 Unmapped Tg(-2.4shha-ABC:DsRed) ZDB-TGCONSTRCT-130125-1 2019-09-17
ZDB-ALT-090129-3 ka3Tg Tg(-2.4shha-E1:GFP)ka3 Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(-2.4shha-E1:GFP) ZDB-TGCONSTRCT-090129-3 2019-09-17
ZDB-ALT-150114-1 ka400Tg Transgenic Insertion embryos treated with DNA Foulkes Lab ZDB-LAB-001113-1 Unmapped Tg(per1b:Luciferase) ZDB-TGCONSTRCT-150114-1 2019-09-17
ZDB-ALT-180302-1 ka404Tg Transgenic Insertion embryos treated with DNA Dickmeis Lab ZDB-LAB-090423-1 Unmapped Tg(EBOX-GCRE:Luciferase) ZDB-TGCONSTRCT-180302-1 2019-09-17
ZDB-ALT-180628-2 ka405 Small Deletion embryos treated with CRISPR1-mlxip Dickmeis Lab ZDB-LAB-090423-1 Chr: 5 2019-09-17
ZDB-ALT-120625-1 ka4Tg Tg(lyz:hyper)ka4 Transgenic Insertion embryos treated with DNA Grabher Lab ZDB-LAB-091130-2 Unmapped Tg(lyz:HyPer) ZDB-TGCONSTRCT-120625-1 2019-09-17
ZDB-ALT-120829-3 ka5Tg Tg(ntn1b:GFP)ka5 Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(ntn1b:GFP) ZDB-TGCONSTRCT-120829-2 2019-09-17
ZDB-ALT-170321-2 ka601 Small Deletion embryos treated with CRISPR3-flt1 the truncated protein is devoid of a functional extracellular Vegfaa binding domain Le Noble Lab ZDB-LAB-160414-1 Chr: 24 2019-09-17
ZDB-ALT-170321-3 ka602 Small Deletion embryos treated with CRISPR3-flt1 the truncated protein is devoid of a functional extracellular Vegfaa binding domain Le Noble Lab ZDB-LAB-160414-1 Chr: 24 2019-09-17
ZDB-ALT-170321-4 ka603 Insertion embryos treated with CRISPR3-flt1 the truncated protein is devoid of a functional extracellular Vegfaa binding domain Le Noble Lab ZDB-LAB-160414-1 Chr: 24 2019-09-17
ZDB-ALT-170321-5 ka604 Small Deletion embryos treated with CRISPR3-flt1 the truncated protein is devoid of a functional extracellular Vegfaa binding domain Le Noble Lab ZDB-LAB-160414-1 Chr: 24 2019-09-17
ZDB-ALT-170321-6 ka605 Insertion embryos treated with CRISPR5-flt1 mutation in exon 11b. Premature stop codon is in the Ig5 domain. Le Noble Lab ZDB-LAB-160414-1 Chr: 24 2019-09-17
ZDB-ALT-170321-7 ka606 Insertion embryos treated with CRISPR5-flt1 mutation in exon 11b. Premature stop codon is in the Ig5 domain. Le Noble Lab ZDB-LAB-160414-1 Chr: 24 2019-09-17
ZDB-ALT-170321-8 ka607 Small Deletion embryos treated with CRISPR5-flt1 mutation in exon 11b. Le Noble Lab ZDB-LAB-160414-1 Chr: 24 2019-09-17
ZDB-ALT-170418-7 ka608 Indel embryos treated with CRISPR5-flt1 1 nucleotide deletion, and A>C change in exon 11b.
These mutations lead to frameshift and premature stop codon Le Noble Lab ZDB-LAB-160414-1 Chr: 24 2019-09-17
ZDB-ALT-130205-2 ka6Tg Tg(2.3gfap:GFP)ka6 Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(2.3gfap:GFP) ZDB-TGCONSTRCT-130205-3 2019-09-17
ZDB-ALT-190719-1 ka701 Small Deletion embryos treated with CRISPR1-sox1a Strähle Lab ZDB-LAB-010827-1 Chr: 9 2019-09-17
ZDB-ALT-190719-2 ka702 Indel embryos treated with CRISPR2-sox1b Strähle Lab ZDB-LAB-010827-1 Chr: 1 2019-09-17
ZDB-ALT-130205-3 ka7Tg Tg(dbx1b:EGFP)ka7 Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(dbx1b:EGFP) ZDB-TGCONSTRCT-130205-2 2019-09-17
ZDB-ALT-160613-2 ka83Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(unc45b:TFP) ZDB-TGCONSTRCT-160613-1 2019-09-17
ZDB-ALT-160608-1 ka84Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped TgBAC(hspb11:EGFP) ZDB-TGCONSTRCT-160608-1 2019-09-17
ZDB-ALT-160608-2 ka85Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(unc45b:GCaMP5a) ZDB-TGCONSTRCT-160608-2 2019-09-17
ZDB-ALT-170112-1 ka86 Small Deletion embryos treated with CRISPR1-dysf Strähle Lab ZDB-LAB-010827-1 Chr: 7 2019-09-17
ZDB-ALT-170112-3 ka87 Unknown embryos treated with CRISPR1-dysf CRISPR targets exon 37, introduces a STOP. Strähle Lab ZDB-LAB-010827-1 Chr: 7 2019-09-17
ZDB-ALT-170112-4 ka88 Unknown embryos treated with CRISPR1-dysf CRISPR targets exon 37, introduces a STOP. Strähle Lab ZDB-LAB-010827-1 Chr: 7 2019-09-17
ZDB-ALT-170112-5 ka89 Unknown embryos treated with CRISPR1-dysf Strähle Lab ZDB-LAB-010827-1 Chr: 7 2019-09-17
ZDB-ALT-130806-9 ka8Tg Tg(actb2:hyper3)ka8 Transgenic Insertion embryos treated with DNA Grabher Lab ZDB-LAB-091130-2 Unmapped Tg(actb2:hyper3) ZDB-TGCONSTRCT-130805-2 2019-09-17
ZDB-ALT-170112-2 ka90 Unknown embryos treated with CRISPR1-irf8 Strähle Lab ZDB-LAB-010827-1 Chr: 18 2019-09-17
ZDB-ALT-170926-1 ka91Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(Hsa.NX_hs54-gata2a:EGFP) ZDB-TGCONSTRCT-170926-2 2019-09-17
ZDB-ALT-170926-2 ka92Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(Hsa.NX_hs79-gata2a:EGFP) ZDB-TGCONSTRCT-170926-1 2019-09-17
ZDB-ALT-170926-3 ka93Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(Hsa.NX_hs162-gata2a:EGFP) ZDB-TGCONSTRCT-170926-5 2019-09-17
ZDB-ALT-170926-4 ka94Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(Hsa.NX_hs226-gata2a:EGFP) ZDB-TGCONSTRCT-170926-3 2019-09-17
ZDB-ALT-170926-5 ka95Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(Hsa.NX_hs375-gata2a:EGFP) ZDB-TGCONSTRCT-170926-4 2019-09-17
ZDB-ALT-180907-2 ka96Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped Tg(-7.2sox10:h2az2a-Eos) ZDB-TGCONSTRCT-180907-1 2019-09-17
ZDB-ALT-150202-1 ka9Tg Transgenic Insertion embryos treated with DNA Strähle Lab ZDB-LAB-010827-1 Unmapped TgBAC(id1:EGFP) ZDB-TGCONSTRCT-150202-1 2019-09-17
ZDB-ALT-080214-1 kb1Tg Tg(EF1a:EGFP-XlCat2)kb1 Transgenic Insertion embryos treated with DNA Inoue Lab ZDB-LAB-970424-70 Unmapped Tg(EF1a:EGFP-Xla.Cat2) ZDB-TGCONSTRCT-080214-1 2019-09-17
ZDB-ALT-120424-4 kb2Tg Tg(actb2:GFP-3xTS)kb2 Transgenic Insertion embryos treated with DNA Inoue Lab ZDB-LAB-970424-70 Unmapped Tg(actb2:GFP-3xts) ZDB-TGCONSTRCT-120424-4 2019-09-17
ZDB-ALT-120424-5 kb3Tg Tg(actb2:GFP-3xTS.1)kb3 Transgenic Insertion embryos treated with DNA Inoue Lab ZDB-LAB-970424-70 Unmapped Tg(actb2:GFP-3xts.1) ZDB-TGCONSTRCT-120424-5 2019-09-17
ZDB-ALT-000611-4 kc10 Unknown Cheng Lab ZDB-LAB-970424-122 Unmapped 2019-09-17
ZDB-ALT-000831-6 kc13 dif-1 Unknown ENU Cheng Lab ZDB-LAB-970424-122 Chr: 18 2019-09-17
ZDB-ALT-000831-2 kc14 Unknown ENU Cheng Lab ZDB-LAB-970424-122 Unmapped 2019-09-17
ZDB-ALT-000831-8 kc15 Unknown ENU Cheng Lab ZDB-LAB-970424-122 Chr: 23 2019-09-17
ZDB-ALT-000611-2 kc16 Unknown Cheng Lab ZDB-LAB-970424-122 Unmapped 2019-09-17
ZDB-ALT-000831-4 kc17 Unknown ENU Cheng Lab ZDB-LAB-970424-122 Chr: 12 2019-09-17
ZDB-ALT-000831-10 kc18 dif-8 Unknown adult males treated with ENU Cheng Lab ZDB-LAB-970424-122 Chr: 23 2019-09-17
ZDB-ALT-010801-2 kca1 16 Point Mutation spontaneous Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Chr: 12 2019-09-17
ZDB-ALT-020703-4 kca11Tg kca11, Tg(dld:GFP)1.3, Tg(dld:GFP)1.3kca11 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(-1.3dld:GFP) ZDB-TGCONSTRCT-070117-144 2019-09-17
ZDB-ALT-071217-3 kca13Tg Tg(h2afva:GFP)kca13, Tg(h2afv:GFP)kca13 Transgenic Insertion embryos treated with DNA Fluorescence fades away within a few minutes in animals carrying Tg(H2AF/Z)kca13 Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(h2az2a:h2az2a-GFP) ZDB-TGCONSTRCT-070117-39 2019-09-17
ZDB-ALT-020703-6 kca19Tg kca19, Tg(dld:GFP)1.8, Tg(dld:GFP)1.8kca19 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(-1.8dld:GFP) ZDB-TGCONSTRCT-070117-29 2019-09-17
ZDB-ALT-040831-14 kca200Tg kca200, Tg(her3:Gal4), Tg(her3:Gal4)kca200 Transgenic Insertion embryos treated with DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(her3:GAL4) ZDB-TGCONSTRCT-070117-97 2019-09-17
ZDB-ALT-020703-24 kca28Tg kca28, Tg(dld:GFP)3.5, Tg(dld:GFP)3.5kca28 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(-3.5dld:GFP) ZDB-TGCONSTRCT-070117-146 2019-09-17
ZDB-ALT-020918-2 kca2Tg kca1, kca2, Tg(-6dld:Gal4)kca2, Tg(dld:Gal4)6, Tg(dld:Gal4)6kca2 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(dld:GAL4) ZDB-TGCONSTRCT-070117-91 2019-09-17
ZDB-ALT-020703-22 kca32Tg kca32, Tg(dld:GFP)6, Tg(dld:GFP)6kca32 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(-6dld:GFP) ZDB-TGCONSTRCT-070117-32 2019-09-17
ZDB-ALT-030716-2 kca33Tg kca33, Tg(UAS:GFP), Tg(UAS:GFP)kca33 Transgenic Insertion embryos treated with DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(UAS:GFP) ZDB-TGCONSTRCT-070117-23 2019-09-17
ZDB-ALT-020703-20 kca37Tg kca37, Tg(dld:GFP)3, Tg(dld:GFP)3kca37 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg1(dld:GFP) ZDB-TGCONSTRCT-070117-30 2019-09-17
ZDB-ALT-020703-30 kca39Tg kca39, Tg(dld:GFP)4.3, Tg(dld:GFP)4.3kca39 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg4(dld:GFP) ZDB-TGCONSTRCT-070117-89 2019-09-17
ZDB-ALT-020918-8 kca3Tg kca1, kca3, Tg(UAS:myc-Notch1a-intra), Tg(UAS:myc-Notch1a-intra)kca3, uas:nicd-myc Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(5xUAS-E1B:6xMYC-notch1a) ZDB-TGCONSTRCT-070117-24 2019-09-17
ZDB-ALT-020703-28 kca41Tg kca41, Tg(dld:GFP)3.8, Tg(dld:GFP)3.8kca41 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg3(dld:GFP) ZDB-TGCONSTRCT-070117-31 2019-09-17
ZDB-ALT-020703-26 kca44Tg kca44, Tg(dld:GFP)5.5, Tg(dld:GFP)5.5kca44 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg5(dld:GFP) ZDB-TGCONSTRCT-070117-147 2019-09-17
ZDB-ALT-020703-18 kca49Tg kca49, Tg(dld:GFP)3.3, Tg(dld:GFP)3.3kca49 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg2(dld:GFP) ZDB-TGCONSTRCT-070117-88 2019-09-17
ZDB-ALT-020918-6 kca4Tg kca4, Tg(hsp70l:Gal4)1.5, Tg(hsp70l:Gal4)1.5kca4 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(-1.5hsp70l:GAL4) ZDB-TGCONSTRCT-070117-42 2019-09-17
ZDB-ALT-020703-14 kca56Tg kca56, Tg(dld:GFP)7, Tg(dld:GFP)7kca56 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg6(dld:GFP) ZDB-TGCONSTRCT-070117-90 2019-09-17
ZDB-ALT-020703-2 kca5Tg kca5, Tg(dld:myc), Tg(dld:myc)kca5 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(dld:dld-MYC) ZDB-TGCONSTRCT-070117-149 2019-09-17
ZDB-ALT-020703-12 kca60Tg kca60, Tg(dld:GFP)7.8, Tg(dld:GFP)7.8kca60 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg7(dld.7:GFP) ZDB-TGCONSTRCT-070117-148 2019-09-17
ZDB-ALT-020703-10 kca64Tg kca64, Tg(dld:GFP)8.3, Tg(dld:GFP)8.3kca64 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg8(dld:GFP) ZDB-TGCONSTRCT-070117-33 2019-09-17
ZDB-ALT-020717-2 kca66Tg kca66, Tg(h2afva:GFP)kca66, Tg(h2afv:GFP)kca66, Tg(h2afz:GFP), Tg(h2afz:GFP)kca66 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(h2az2a:h2az2a-GFP) ZDB-TGCONSTRCT-070117-39 2019-09-17
ZDB-ALT-020703-8 kca67Tg kca67, Tg(dld:GFP)10, Tg(dld:GFP)10kca67 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg9(dld:GFP) ZDB-TGCONSTRCT-070117-87 2019-09-17
ZDB-ALT-020918-4 kca6Tg H2B-GFP, kca37, kca6, Tg(h2afva:GFP)kca6, Tg(h2afv:GFP)kca6, Tg(h2afz:GFP), Tg(h2afz:GFP)kca6 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(h2az2a:h2az2a-GFP) ZDB-TGCONSTRCT-070117-39 2019-09-17
ZDB-ALT-020703-16 kca70Tg kca70, Tg(dld:GFP)12.5, Tg(dld:GFP)12.5kca70 Transgenic Insertion DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg10(dld:GFP) ZDB-TGCONSTRCT-070117-145 2019-09-17
ZDB-ALT-060619-2 kca7Tg kca7, Tg(UAS:shha), Tg(UAS:shha)kca7 Transgenic Insertion embryos treated with DNA Reugels / Campos-Ortega Lab ZDB-LAB-970409-69 Unmapped Tg(UAS:shha) ZDB-TGCONSTRCT-070117-82 2019-09-17
ZDB-ALT-091027-22 kctd12.1_unrecovered un_kctd12.1, unrec_kctd12.1, unrec_leftover (kct12.1), unrecovered_kctd12.1 Point Mutation adult males treated with ENU Chr: 9 2019-09-17
ZDB-ALT-091027-20 kctd12.2_unrecovered un_kctd12.2, unrec_kctd12.2, unrecovered_kctd12.2 Point Mutation adult males treated with ENU Chr: 1 2019-09-17
ZDB-ALT-180207-6 kg101 Small Deletion embryos treated with CRISPR1-cnrip1b Simon M. Hughes Lab ZDB-LAB-970807-3 Chr: 13 2019-09-17
ZDB-ALT-190125-4 kg125 Small Deletion embryos treated with CRISPR1-myog Simon M. Hughes Lab ZDB-LAB-970807-3 Ambiguous 2019-09-17
ZDB-ALT-190125-5 kg128 Insertion embryos treated with CRISPR1-myog Simon M. Hughes Lab ZDB-LAB-970807-3 Chr: 11 2019-09-17
ZDB-ALT-190830-13 kg134 Indel embryos treated with CRISPR1-egfra Simon M. Hughes Lab ZDB-LAB-970807-3 Chr: 2 2019-09-17
ZDB-ALT-130110-1 kg1Tg Tg(5xUAS:sypb-GCaMP3,myl7:EGFP)kg1 Transgenic Insertion embryos treated with DNA Meyer Lab ZDB-LAB-121212-1 Unmapped Tg(5xUAS:sypb-GCaMP3,myl7:EGFP) ZDB-TGCONSTRCT-130110-1 2019-09-17
ZDB-ALT-161007-4 kg302Tg Transgenic Insertion embryos treated with DNA Hindges Lab ZDB-LAB-161007-2 Unmapped TgBAC(tenm3:GAL4FF) ZDB-TGCONSTRCT-161006-1 2019-09-17
ZDB-ALT-171205-3 kg312Tg Transgenic Insertion embryos treated with DNA Linker Lab ZDB-LAB-160916-1 Unmapped Tg(-4.9sox10:Hsa.HIST1H2BJ-mCherry-2A-GLYPI-EGFP) ZDB-TGCONSTRCT-171205-3 2019-09-17
ZDB-ALT-170612-3 kg41 coma Point Mutation adult males treated with ENU A null allele located at 56.2 cM on chromosome 19. The point mutation is at nucleotide position +604 from the ATG start site. Houart Lab ZDB-LAB-001117-1 Chr: 19 2019-09-17
ZDB-ALT-161123-1 kg69 Small Deletion embryos treated with TALEN1-tenm3 Deletion in chromosome 1: 38,921,612 - 38,921,625.
The deletion is in the exon encoding the transmembrane domain of Trenm3. The entire extracellular domain is lost in the mutated protein. Hindges Lab ZDB-LAB-161007-2 Chr: 1 2019-09-17
ZDB-ALT-180207-5 kg96 Insertion embryos treated with CRISPR2-cnrip1a Simon M. Hughes Lab ZDB-LAB-970807-3 Chr: 1 2019-09-17
ZDB-ALT-180207-4 kg98 Small Deletion embryos treated with CRISPR1-cnrip1a Simon M. Hughes Lab ZDB-LAB-970807-3 Chr: 1 2019-09-17
ZDB-ALT-161115-6 ki102Tg Transgenic Insertion embryos treated with DNA Andersson Lab ZDB-LAB-140722-1 Unmapped Tg(sst2:NTR,cryaa:Cerulean) ZDB-TGCONSTRCT-161115-8 2019-09-17
ZDB-ALT-161115-7 ki103Tg Transgenic Insertion embryos treated with DNA Andersson Lab ZDB-LAB-140722-1 Unmapped Tg(actb2:igfbp1a,myl7:EGFP) ZDB-TGCONSTRCT-161115-7 2019-09-17
ZDB-ALT-161115-8 ki104Tg Transgenic Insertion embryos treated with DNA Andersson Lab ZDB-LAB-140722-1 Unmapped Tg(actb2:igfbp1a,myl7:EGFP) ZDB-TGCONSTRCT-161115-7 2019-09-17
ZDB-ALT-161115-9 ki105Tg Transgenic Insertion embryos treated with DNA Andersson Lab ZDB-LAB-140722-1 Unmapped Tg(actb2:igfbp1a,myl7:EGFP) ZDB-TGCONSTRCT-161115-7 2019-09-17
ZDB-ALT-161115-10 ki106Tg Transgenic Insertion embryos treated with DNA Andersson Lab ZDB-LAB-140722-1 Unmapped Tg(pcsk1:EGFP) ZDB-TGCONSTRCT-161115-10 2019-09-17
ZDB-ALT-161115-11 ki107Tg Transgenic Insertion embryos treated with DNA Andersson Lab ZDB-LAB-140722-1 Unmapped Tg(ins:Venus-gmnn,cryaa:Venus) ZDB-TGCONSTRCT-161115-9 2019-09-17
ZDB-ALT-170313-1 ki108Tg ki108 Transgenic Insertion embryos treated with DNA Andersson Lab ZDB-LAB-140722-1 Unmapped Tg(EPV.Tp1:cdk5rap1,myl7:EGFP) ZDB-TGCONSTRCT-180813-1 2019-09-17
ZDB-ALT-180813-1 ki109Tg Transgenic Insertion embryos treated with DNA Andersson Lab ZDB-LAB-140722-1 Unmapped Tg(EPV.Tp1:cdkal1,myl7:EGFP) ZDB-TGCONSTRCT-180813-2 2019-09-17
ZDB-ALT-171212-5 ki110 Small Deletion embryos treated with CRISPR1-cdk5 Andersson Lab ZDB-LAB-140722-1 Chr: 24 2019-09-17
ZDB-ALT-120613-1 ki1Tg Tg(-2.5nphs2:EGFP)ki1 Transgenic Insertion embryos treated with DNA Betsholtz Lab ZDB-LAB-120613-1 Unmapped Tg(-2.5nphs2:EGFP) ZDB-TGCONSTRCT-120613-1 2019-09-17
ZDB-ALT-180808-1 ki208 Unknown Andersson-Lendahl Lab ZDB-LAB-170130-1 Unmapped 2019-09-17
ZDB-ALT-150409-13 ki2Tg Transgenic Insertion embryos treated with DNA Tryggvason Lab ZDB-LAB-150407-1 Unmapped Tg(-2.5cdh17:mCherry) ZDB-TGCONSTRCT-150409-1 2019-09-17
ZDB-ALT-161020-3 ki3Tg Transgenic Insertion embryos treated with DNA Helleday Lab ZDB-LAB-160817-1 Unmapped Tg(actb2:Hsa.GLRX-roGFP,myl7:EGFP) ZDB-TGCONSTRCT-161020-3 2019-09-17
ZDB-ALT-110126-1 kita_unspecified Unspecified This record has been created in support of data for which a publication has not specified an allele. Chr: 20 2019-09-17
ZDB-ALT-130823-1 kj100Tg Tg(Tru.Myhz1.1:EGFP)kj100 Transgenic Insertion embryos treated with DNA Watabe Lab ZDB-LAB-120209-5 Unmapped Tg(Tru.Myhm86-2:EGFP) ZDB-TGCONSTRCT-130605-1 2019-09-17
ZDB-ALT-160315-1 kj102Tg Transgenic Insertion embryos treated with DNA Watabe Lab ZDB-LAB-120209-5 Unmapped Tg(-2.1Tru.Myhm:EGFP) ZDB-TGCONSTRCT-160315-1 2019-09-17
ZDB-ALT-160317-3 kj103Tg Transgenic Insertion embryos treated with DNA Watabe Lab ZDB-LAB-120209-5 Unmapped Tg(myhz2:EGFP) ZDB-TGCONSTRCT-160317-1 2019-09-17
ZDB-ALT-160317-4 kj104Tg Transgenic Insertion embryos treated with DNA Watabe Lab ZDB-LAB-120209-5 Unmapped Tg(myhz1.2:EGFP) ZDB-TGCONSTRCT-160317-2 2019-09-17
ZDB-ALT-090622-1 kj10Tg Tg(-5.2opn1sw2:EGFP)kj10, Tg(zfSWS2-5.2A:EGFP) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-5.2opn1sw2:EGFP) ZDB-TGCONSTRCT-090622-1 2019-09-17
ZDB-ALT-090622-2 kj11Tg Tg(-3.5opn1sw2:EGFP)kj11, Tg(zfSWS2-3.5A:EGFP) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-3.5opn1sw2:EGFP) ZDB-TGCONSTRCT-090622-2 2019-09-17
ZDB-ALT-090622-3 kj12Tg Tg(-1.7opn1sw2:EGFP)kj12, Tg(zfSWS2-1.7A:EGFP) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-1.7opn1sw2:EGFP) ZDB-TGCONSTRCT-090622-3 2019-09-17
ZDB-ALT-090622-4 kj13Tg Tg(-1.1opn1sw2:EGFP)kj13, Tg(zfSWS2-1.1A:EGFP) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-1.1opn1sw2:EGFP) ZDB-TGCONSTRCT-090622-5 2019-09-17
ZDB-ALT-110519-1 kj14Tg Tg(LWS1/GFP-LWS2/RFP-PAC(E))#1229, Tg_PACE(opn1lw1:GFP, cxxc1:RFP)kj14, TgPAC(opn1lw1.1:GFP, cxxc1:RFP)kj14 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg1PAC(opn1lw1:GFP,cxxc1:RFP) ZDB-TGCONSTRCT-110519-3 2019-09-17
ZDB-ALT-110519-2 kj15Tg Tg(LWS1/GFP-LWS2/RFP-PAC(H))#430, TgPAC(2opn1lw1:GFP, cxxc1:RFP)kj15, Tg_PACH(opn1lw1:GFP, cxxc1:RFP)kj15, TgPAC(opn1lw1.2:GFP, cxxc1:RFP)kj15, TgPAC(opn1lw1:GFP, cxxc1:RFP)kj15 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg2PAC(opn1lw1:GFP,cxxc1:RFP) ZDB-TGCONSTRCT-110519-4 2019-09-17
ZDB-ALT-110519-3 kj16aTg kjkj16a, Tg(-2.6opn1lw1:GFP, -1.8cxxc1:RFP)kj16a, Tg(LWS1up2.6kb:GFP-LWS2up1.8kb:RFP)#1464 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-2.6opn1lw1:GFP,-1.8cxxc1:RFP) ZDB-TGCONSTRCT-110519-5 2019-09-17
ZDB-ALT-110519-4 kj16bTg Tg(-2.6opn1lw1:GFP, -1.8cxxc1:RFP)kj16b, Tg(LWS1up2.6kb:GFP-LWS2up1.8kb:RFP)#1631 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-2.6opn1lw1:GFP,-1.8cxxc1:RFP) ZDB-TGCONSTRCT-110519-5 2019-09-17
ZDB-ALT-110519-5 kj16cTg Tg(-2.6opn1lw1:GFP, -1.8cxxc1:RFP)kj16c, Tg(LWS1up2.6kb:GFP-LWS2up1.8kb:RFP)#1640 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-2.6opn1lw1:GFP,-1.8cxxc1:RFP) ZDB-TGCONSTRCT-110519-5 2019-09-17
ZDB-ALT-110519-6 kj17aTg Tg(-2.6opn1lw1:GFP)kj17a, Tg(LWS1up2.6kb:GFP)#1508 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-2.6opn1lw1:GFP) ZDB-TGCONSTRCT-110519-6 2019-09-17
ZDB-ALT-110519-7 kj17bTg Tg(-2.6opn1lw1:GFP)kj17b, Tg(LWS1up2.6kb:GFP)#1509 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-2.6opn1lw1:GFP) ZDB-TGCONSTRCT-110519-6 2019-09-17
ZDB-ALT-110519-8 kj17cTg Tg(-2.6opn1lw1:GFP)kj17c, Tg(LWS1up2.6kb:GFP)#1509 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-2.6opn1lw1:GFP) ZDB-TGCONSTRCT-110519-6 2019-09-17
ZDB-ALT-110519-9 kj18Tg Tg(-1.8cxxc1:GFP)kj18, Tg(LWS2up1.8kb:GFP)#1433 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-1.8cxxc1:GFP) ZDB-TGCONSTRCT-110519-7 2019-09-17
ZDB-ALT-110519-10 kj19aTg Tg(-0.6opn1lw1-cxxc1:GFP)kj19a, Tg(LAR:LWS2up1.8kb:GFP)#1481 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-0.6opn1lw1-cxxc1:GFP) ZDB-TGCONSTRCT-110519-8 2019-09-17
ZDB-ALT-110519-11 kj19bTg Tg(-0.6opn1lw1-cxxc1:GFP)kj19b, Tg(LAR:LWS2up1.8kb:GFP)#1491 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-0.6opn1lw1-cxxc1:GFP) ZDB-TGCONSTRCT-110519-8 2019-09-17
ZDB-ALT-110519-12 kj19cTg Tg(-0.6opn1lw1-cxxc1:GFP)kj19c, Tg(LAR:LWS2up1.8kb:GFP)#1496 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-0.6opn1lw1-cxxc1:GFP) ZDB-TGCONSTRCT-110519-8 2019-09-17
ZDB-ALT-110519-13 kj19dTg Tg(-0.6opn1lw1-cxxc1:GFP)kj19d, Tg(LAR:LWS2up1.8kb:GFP)#1499 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-0.6opn1lw1-cxxc1:GFP) ZDB-TGCONSTRCT-110519-8 2019-09-17
ZDB-ALT-110519-14 kj19eTg Tg(-0.6opn1lw1-cxxc1:GFP)kj19e, Tg(LAR:LWS2up1.8kb:GFP)#1501 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-0.6opn1lw1-cxxc1:GFP) ZDB-TGCONSTRCT-110519-8 2019-09-17
ZDB-ALT-060830-2 kj1Tg kj1, Tg(-1.1rho:EGFP), Tg(-1.1rho:EGFP)kj1, Tg(-1.1rho:EGFP)unspecified, Tg(zfRh1-1.1B:EGFP) Transgenic Insertion DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-1.1rho:EGFP) ZDB-TGCONSTRCT-070117-118 2019-09-17
ZDB-ALT-110519-15 kj20aTg Tg(-0.6opn1lw1-krt8:GFP)kj20a, Tg(LAR:krt8up564bp:GFP)#1469 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-0.6opn1lw1-krt8:GFP) ZDB-TGCONSTRCT-110519-9 2019-09-17
ZDB-ALT-110519-16 kj20bTg Tg(-0.6opn1lw1-krt8:GFP)kj20b, Tg(LAR:krt8up564bp:GFP)#1477 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-0.6opn1lw1-krt8:GFP) ZDB-TGCONSTRCT-110519-9 2019-09-17
ZDB-ALT-110519-17 kj21aTg Tg(LAR-LWS1/GFP-LWS2/RFP-PAC(E))#1143, Tg_PACE(1opn1lw1:GFP, cxxc1:RFP)kj21a, TgPAC(opn1lw1.3:GFP, cxxc1:RFP)kj21a Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg3PAC(opn1lw1:GFP,cxxc1:RFP) ZDB-TGCONSTRCT-110519-10 2019-09-17
ZDB-ALT-110519-18 kj21bTg Tg(LAR-LWS1/GFP-LWS2/RFP-PAC(E))#1166, Tg_PACE(1opn1lw1:GFP, cxxc1:RFP)kj21b, TgPAC(opn1lw1.3:GFP, cxxc1:RFP)kj21b Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg3PAC(opn1lw1:GFP,cxxc1:RFP) ZDB-TGCONSTRCT-110519-10 2019-09-17
ZDB-ALT-110519-19 kj22aTg Tg(LAR-LWS1/GFP-LWS2/RFP-PAC(H))#1100, TgPAC(1opn1lw1.4:GFP, cxxc1:RFP)kj22a, TgPAC(1opn1lw1:GFP, cxxc1:RFP)kj22a, Tg_PACH(1opn1lw1:GFP, cxxc1:RFP)kj22a, TgPAC(opn1lw1.4:GFP, cxxc1:RFP)kj22a Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg4PAC(opn1lw1:GFP,cxxc1:RFP) ZDB-TGCONSTRCT-110519-11 2019-09-17
ZDB-ALT-110519-20 kj22bTg Tg(LAR-LWS1/GFP-LWS2/RFP-PAC(H))#1107, TgPAC(1opn1lw1.4:GFP, cxxc1:RFP)kj22b, TgPAC(1opn1lw1:GFP, cxxc1:RFP)kj22b, Tg_PACH(1opn1lw1:GFP, cxxc1:RFP)kj22b, TgPAC(opn1lw1.4:GFP, cxxc1:RFP)kj22b Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg4PAC(opn1lw1:GFP,cxxc1:RFP) ZDB-TGCONSTRCT-110519-11 2019-09-17
ZDB-ALT-190422-3 kj23Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-krt4:EGFP) ZDB-TGCONSTRCT-190422-4 2019-09-17
ZDB-ALT-190422-4 kj24Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw1:EGFP) ZDB-TGCONSTRCT-190422-5 2019-09-17
ZDB-ALT-190422-5 kj25Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw2:EGFP) ZDB-TGCONSTRCT-190422-6 2019-09-17
ZDB-ALT-190422-6 kj26Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw3:EGFP) ZDB-TGCONSTRCT-190422-7 2019-09-17
ZDB-ALT-190422-7 kj27Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw4:EGFP) ZDB-TGCONSTRCT-190422-8 2019-09-17
ZDB-ALT-190424-1 kj28Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped TgPAC(lcr.opn-opn1mw1:GFP,opn1mw2:RFP) ZDB-TGCONSTRCT-190425-3 2019-09-17
ZDB-ALT-190424-2 kj29Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped TgPAC(lcr.opn-opn1mw3:GFP,opn1mw4:RFP) ZDB-TGCONSTRCT-190425-2 2019-09-17
ZDB-ALT-060830-4 kj2Tg kj2, Tg(-3.7rho:EGFP), Tg(-3.7rho:EGFP)kj2, Tg(-3.7rho:EGFP)unspecified, Tg(zfRh1-3.7B:EGFP) Transgenic Insertion DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-3.7rho:EGFP) ZDB-TGCONSTRCT-070117-125 2019-09-17
ZDB-ALT-190424-3 kj30Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw1:EGFP,opn1mw3:RFP) ZDB-TGCONSTRCT-190425-4 2019-09-17
ZDB-ALT-190424-4 kj31Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw1:EGFP,opn1mw4:RFP) ZDB-TGCONSTRCT-190425-5 2019-09-17
ZDB-ALT-190424-5 kj32Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-krt4:EGFP,opn1mw4:RFP) ZDB-TGCONSTRCT-190425-6 2019-09-17
ZDB-ALT-190424-6 kj33Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw4:EGFP,opn1mw3:RFP) ZDB-TGCONSTRCT-190425-7 2019-09-17
ZDB-ALT-190424-7 kj34Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw3:EGFP,opn1mw2:RFP) ZDB-TGCONSTRCT-190425-8 2019-09-17
ZDB-ALT-190424-8 kj35Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(lcr.opn-opn1mw3:EGFP,opn1mw4:RFP) ZDB-TGCONSTRCT-190425-9 2019-09-17
ZDB-ALT-190429-1 kj36Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped TgPAC(opn1mw2:GFP-opn1mw3-lcr.opn) ZDB-TGCONSTRCT-190430-2 2019-09-17
ZDB-ALT-190429-2 kj37Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped TgPAC(opn1mw3:GFP-lcr.opn) ZDB-TGCONSTRCT-190429-2 2019-09-17
ZDB-ALT-190425-1 kj38Tg Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped TgPAC(lcr.opn-opn1mw4:GFP) ZDB-TGCONSTRCT-190425-10 2019-09-17
ZDB-ALT-071206-1 kj3Tg Tg(opn1mw1:EGFP)kj3, Tg(RH2-1/GFP-PAC) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(opn1mw1:EGFP) ZDB-TGCONSTRCT-071206-1 2019-09-17
ZDB-ALT-071206-2 kj4Tg Tg(opn1mw2:EGFP)kj4, Tg(RH2-2/GFP-PAC) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(opn1mw2:EGFP) ZDB-TGCONSTRCT-071206-2 2019-09-17
ZDB-ALT-071206-3 kj5Tg Tg(opn1mw3:EGFP)kj5, Tg(RH2-3/GFP-PAC) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(opn1mw3:EGFP) ZDB-TGCONSTRCT-071206-3 2019-09-17
ZDB-ALT-071206-4 kj6Tg Tg(opn1mw4:EGFP)kj6, Tg(RH2-4/GFP-PAC) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(opn1mw4:EGFP) ZDB-TGCONSTRCT-071206-4 2019-09-17
ZDB-ALT-071206-5 kj7Tg Tg(LCR:2-1), Tg(RH2-LCR-1.5opn1mw1:EGFP)kj7 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(opn1mw1LCR:EGFP) ZDB-TGCONSTRCT-071206-5 2019-09-17
ZDB-ALT-071206-6 kj8Tg Tg(LCR-krt8), Tg(RH2-LCR-krt4:EGFP)kj8, Tg(RH2-LCR-krt8:EGFP)kj8 Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(opn1mw1LCR-krt4:EGFP) ZDB-TGCONSTRCT-071206-6 2019-09-17
ZDB-ALT-080227-1 kj9Tg Tg(-5.5opn1sw1:EGFP)kj9, Tg(zfSWS1-5.5A:EGFP) Transgenic Insertion embryos treated with DNA Kawamura Lab ZDB-LAB-031211-1 Unmapped Tg(-5.5opn1sw1:EGFP) ZDB-TGCONSTRCT-080227-1 2019-09-17
ZDB-ALT-130619-1 km1Tg Tg(hsp70l:axin2-EGFP)km1 Transgenic Insertion embryos treated with DNA Hae-Chul Park Lab ZDB-LAB-130610-1 Unmapped Tg(hsp70l:axin2-EGFP) ZDB-TGCONSTRCT-130618-1 2019-09-17
ZDB-ALT-130619-2 km2Tg Tg(hsp70l:ihhb-mCherry)km2 Transgenic Insertion embryos treated with DNA Hae-Chul Park Lab ZDB-LAB-130610-1 Unmapped Tg(hsp70l:ihhb-mCherry) ZDB-TGCONSTRCT-130619-1 2019-09-17
ZDB-ALT-150803-1 km5Tg Transgenic Insertion embryos treated with DNA Hae-Chul Park Lab ZDB-LAB-130610-1 Unmapped Tg(mbpa:GAL4-VP16) ZDB-TGCONSTRCT-150803-1 2019-09-17
ZDB-ALT-150803-2 km6Tg Transgenic Insertion embryos treated with DNA Hae-Chul Park Lab ZDB-LAB-130610-1 Unmapped Tg2(sox10:GAL4-VP16) ZDB-TGCONSTRCT-150803-2 2019-09-17
ZDB-ALT-161102-5 km7Tg Transgenic Insertion embryos treated with DNA Hae-Chul Park Lab ZDB-LAB-130610-1 Unmapped TgBAC(galr2b:EGFP) ZDB-TGCONSTRCT-161102-5 2019-09-17
ZDB-ALT-110408-8 kn1Tg Tg(hsp70l:cyp26a1)kn1 Transgenic Insertion embryos treated with DNA Axel Meyer Lab ZDB-LAB-970507-55 Unmapped Tg(hsp70l:cyp26a1) ZDB-TGCONSTRCT-110408-6 2019-09-17
ZDB-ALT-120809-1 kn2Tg TgBAC(1aldh1a2:aldh1a2-GFP)kn2 Transgenic Insertion embryos treated with DNA Axel Meyer Lab ZDB-LAB-970507-55 Unmapped Tg1BAC(aldh1a2:aldh1a2-GFP) ZDB-TGCONSTRCT-160325-4 2019-09-17
ZDB-ALT-120809-2 kn3Tg TgBAC(2aldh1a2:aldh1a2-GFP)kn3 Transgenic Insertion embryos treated with DNA Axel Meyer Lab ZDB-LAB-970507-55 Unmapped TgBAC(2aldh1a2:aldh1a2-GFP) ZDB-TGCONSTRCT-120809-2 2019-09-17
ZDB-ALT-170124-1 kn4Tg Transgenic Insertion embryos treated with DNA Stürmer Lab ZDB-LAB-971020-5 Unmapped Tg(mbpa:mCherry-2A-Cre-ERT2) ZDB-TGCONSTRCT-170124-1 2019-09-17
ZDB-ALT-170124-2 kn5Tg Transgenic Insertion embryos treated with DNA Stürmer Lab ZDB-LAB-971020-5 Unmapped Tg(mbpa:mCherry-2A-Cre-ERT2) ZDB-TGCONSTRCT-170124-1 2019-09-17
ZDB-ALT-070612-1 knu1Tg Tg(her4.1:nlsEGFP)knu1 Transgenic Insertion embryos treated with DNA Yeo Lab ZDB-LAB-070611-1 Unmapped Tg(her4.3:NLS-EGFP) ZDB-TGCONSTRCT-070612-1 2019-09-17
ZDB-ALT-070612-2 knu2Tg Tg(her4.1:dRFP)knu2 Transgenic Insertion embryos treated with DNA Yeo Lab ZDB-LAB-070611-1 Unmapped Tg(her4.3:dRFP) ZDB-TGCONSTRCT-070612-2 2019-09-17
ZDB-ALT-060301-2 knu3Tg Tg(elavl3:EGFP), Tg(elavl3:EGFP)knu3, Tg(elavl3:EGFP)unspecified, Tg(elavl3:EGFP)zf8, zf8 Transgenic Insertion embryos treated with DNA Huh Lab ZDB-LAB-090410-1 Unmapped Tg(elavl3:EGFP) ZDB-TGCONSTRCT-070117-150 2019-09-17
ZDB-ALT-090422-1 knu4Tg Tg(hsp70:fz8aCRDTM-egfp), Tg(hsp70l:fzd8a-EGFP)knu4, Tg(hsp70l:fzd8a-EGFP)zf133, zf133 Transgenic Insertion embryos treated with DNA Huh Lab ZDB-LAB-090410-1 Unmapped Tg(hsp70l:fzd8a-EGFP) ZDB-TGCONSTRCT-090422-1 2019-09-17
ZDB-ALT-120717-4 knu6 dalmuri Point Mutation ENU The mutation is a G to T substitution, resulting in a premature stop codon (TGA) at Gly-42 (GGA). Huh Lab ZDB-LAB-090410-1 Chr: 18 2019-09-17
ZDB-ALT-100616-1 knu9Tg Tg(vmhc:GFP)knu9 Transgenic Insertion embryos treated with DNA Huh Lab ZDB-LAB-090410-1 Unmapped Tg(-1.8myh7:EGFP) ZDB-TGCONSTRCT-100616-1 2019-09-17
ZDB-ALT-110214-6 ko02Tg Tg(-2.4lyz:EGFP)ko02 Transgenic Insertion embryos treated with DNA Kawahara Lab ZDB-LAB-060907-1 Unmapped Tg(-2.4lyz:EGFP) ZDB-TGCONSTRCT-110214-5 2019-09-17
ZDB-ALT-110214-7 ko03Tg Tg(-2.4lyz:EGFP)ko03 Transgenic Insertion embryos treated with DNA Kawahara Lab ZDB-LAB-060907-1 Unmapped Tg(-2.4lyz:EGFP) ZDB-TGCONSTRCT-110214-5 2019-09-17
ZDB-ALT-110214-8 ko04Tg Tg(-2.4lyz:EGFP)ko04 Transgenic Insertion embryos treated with DNA Kawahara Lab ZDB-LAB-060907-1 Unmapped Tg(-2.4lyz:EGFP) ZDB-TGCONSTRCT-110214-5 2019-09-17
ZDB-ALT-110214-9 ko05Tg ko5, Tg(-8.1gata1a:mRFP)ko05 Transgenic Insertion embryos treated with DNA Kawahara Lab ZDB-LAB-060907-1 Unmapped Tg(-8.1gata1a:mRFP) ZDB-TGCONSTRCT-110214-6 2019-09-17
ZDB-ALT-090423-2 ko07Tg Tg(myl7:mRFP)ko07 Transgenic Insertion embryos treated with DNA Kawahara Lab ZDB-LAB-060907-1 Unmapped Tg(myl7:mRFP) ZDB-TGCONSTRCT-080917-1 2019-09-17
ZDB-ALT-090423-3 ko08Tg Tg(myl7:mRFP)ko08 Transgenic Insertion embryos treated with DNA Kawahara Lab ZDB-LAB-060907-1 Unmapped Tg(myl7:mRFP) ZDB-TGCONSTRCT-080917-1 2019-09-17
ZDB-ALT-090709-1 ko095 Point Mutation adult males treated with ENU Kawahara Lab ZDB-LAB-060907-1 Chr: 23 2019-09-17
ZDB-ALT-130522-1 ko09Tg Tg(flk1:mRFP), Tg(kdrl:mRFP)ko09 Transgenic Insertion embryos treated with DNA Kawahara Lab ZDB-LAB-060907-1 Unmapped Tg(kdrl:mRFP) ZDB-TGCONSTRCT-130521-1 2019-09-17
ZDB-ALT-161103-6 ko10 Indel embryos treated with TALEN1-lbx1b Shukunami Lab ZDB-LAB-160802-1 Chr: 1 2019-09-17
ZDB-ALT-190805-3 ko107 Small Deletion embryos treated with CRISPR1-mrpl19 Sehara-Fujisawa Lab ZDB-LAB-160803-1 Unmapped 2019-09-17
ZDB-ALT-190711-5 ko108 Small Deletion embryos treated with CRISPR2-itga4, CRISPR3-itga4 2.0-kb deletion between the exon-4 and -7 of itga4 Sehara-Fujisawa Lab ZDB-LAB-160803-1 Unmapped 2019-09-17
ZDB-ALT-160805-1 ko109 Small Deletion embryos treated with CRISPR1-adam12 Insertion of artificial stop codon due to 2 bases deletion Sehara-Fujisawa Lab ZDB-LAB-160803-1 Chr: 17 2019-09-17
ZDB-ALT-161103-7 ko11 Indel embryos treated with TALEN1-lbx2 Shukunami Lab ZDB-LAB-160802-1 Chr: 14 2019-09-17
ZDB-ALT-160804-1 ko110Tg Transgenic Insertion embryos treated with DNA Sehara-Fujisawa Lab ZDB-LAB-160803-1 Unmapped Tg(adam12:EGFP) ZDB-TGCONSTRCT-160803-3 2019-09-17
ZDB-ALT-180821-4 ko111Tg Transgenic Insertion embryos treated with DNA Sehara-Fujisawa Lab ZDB-LAB-160803-1 Unmapped Tg2(gata1a:GFP) ZDB-TGCONSTRCT-180821-4 2019-09-17
ZDB-ALT-180821-2 ko112Tg Transgenic Insertion embryos treated with DNA Sehara-Fujisawa Lab ZDB-LAB-160803-1 Unmapped Tg(UAS:mCherry-DNitgb1a) ZDB-TGCONSTRCT-180821-2 2019-09-17
ZDB-ALT-180821-3 ko113Tg Transgenic Insertion embryos treated with DNA Sehara-Fujisawa Lab ZDB-LAB-160803-1 Unmapped Tg7(UAS:mCherry) ZDB-TGCONSTRCT-180821-3 2019-09-17
ZDB-ALT-090423-1 ko157 Point Mutation adult males treated with ENU Kawahara Lab ZDB-LAB-060907-1 Chr: 5 2019-09-17
ZDB-ALT-070919-1 ko1Tg Tg(kdr:EGFP)ko1 Transgenic Insertion embryos treated with DNA Kawahara Lab ZDB-LAB-060907-1 Unmapped Tg1(kdr:EGFP) ZDB-TGCONSTRCT-070919-1 2019-09-17
ZDB-ALT-190403-1 ko201 c.232 C > T Point Mutation embryos treated with CRISPR5-chrd Maegawa Lab ZDB-LAB-190401-1 Chr: 15 2019-09-17
ZDB-ALT-190403-2 ko202 oep c.178C>T Point Mutation embryos treated with CRISPR1-tdgf1 Maegawa Lab ZDB-LAB-190401-1 Chr: 10 2019-09-17
ZDB-ALT-140411-4 ko311 Small Deletion embryos treated with TALEN1-s1pr1 Deletion from 362 to 371 of the s1pr1 coding region resulting in a gene that has 120 correct amino acids from the start codon and two incorrect amino acids Kawahara Lab ZDB-LAB-060907-1 Chr: 22 2019-09-17
ZDB-ALT-140411-5 ko322 Small Deletion embryos treated with TALEN1-s1pr2 Deletion from 179 to 188 of the s1pr2 coding region. The resulting allele encods for 59 correct amino acids from the start codon and 10 incorrect amino acids. Kawahara Lab ZDB-LAB-060907-1 Chr: 3 2019-09-17
ZDB-ALT-160217-9 ko333 Small Deletion embryos treated with TALEN1-s1pr3a A 14-base pair deletion in s1pr3a, encodes for 22 correct amino acids from the start codon and five incorrect amino acids. Kawahara Lab ZDB-LAB-060907-1 Chr: 22 2019-09-17
ZDB-ALT-160217-11 ko344 Small Deletion embryos treated with TALEN1-s1pr4 An 8-base pair deletion in s1pr4, encodes for 86 correct amino acids from the start codon and two incorrect amino acids. Kawahara Lab ZDB-LAB-060907-1 Chr: 22 2019-09-17
ZDB-ALT-160217-12 ko355 Small Deletion embryos treated with TALEN1-s1pr5a A 5-base pair deletion in s1pr5a, that encods for 77 correct amino acids from the start codon and 23 incorrect amino acids. Kawahara Lab ZDB-LAB-060907-1 Chr: 3 2019-09-17
ZDB-ALT-160217-10 ko366 Small Deletion embryos treated with TALEN1-s1pr3b A 19-base pair deletion in s1pr3b which encodes for 90 correct amino acids from the start codon and 21 incorrect amino acids. Kawahara Lab ZDB-LAB-060907-1 Chr: 21 2019-09-17
ZDB-ALT-160217-13 ko377 Small Deletion embryos treated with TALEN1-s1pr5b An 11-base pair deletion in s1pr5b, that encodes for 14 correct amino acids from the start codon and 41 incorrect amino acids. Kawahara Lab ZDB-LAB-060907-1 Chr: 6 2019-09-17
ZDB-ALT-161018-1 ko501Tg Transgenic Insertion embryos treated with DNA Shukunami Lab ZDB-LAB-160802-1 Unmapped Tg(hsp70l:GAL4-VP16-EGFP,myl7:EGFP) ZDB-TGCONSTRCT-161005-2 2019-09-17
ZDB-ALT-161018-2 ko502Tg Transgenic Insertion embryos treated with DNA Shukunami Lab ZDB-LAB-160802-1 Unmapped Tg(UAS:lbx1b-EGFP,myl7:EGFP) ZDB-TGCONSTRCT-161018-1 2019-09-17
ZDB-ALT-161018-3 ko503Tg Transgenic Insertion embryos treated with DNA Shukunami Lab ZDB-LAB-160802-1 Unmapped Tg(UAS:mCherry-EGFP,myl7:EGFP) ZDB-TGCONSTRCT-161018-2 2019-09-17
ZDB-ALT-161018-4 ko504Tg Transgenic Insertion embryos treated with DNA Shukunami Lab ZDB-LAB-160802-1 Unmapped Tg(lbx1b-gata2a:lbx1b,myl7:EGFP) ZDB-TGCONSTRCT-161018-3 2019-09-17
ZDB-ALT-151007-28 ko811 Small Deletion embryos treated with TALEN1-sphk1 Hisano et al (2015): 13 deleted bases in sphk1; 74 correct amino acids from the start codon and 39 incorrect amino acids [lack the sphingosine-binding domain] Kawahara Lab ZDB-LAB-060907-1 Unmapped 2019-09-17
ZDB-ALT-151007-29 ko822 Indel embryos treated with TALEN1-sphk2 Hisano et al (2015): two deleted bases and three inserted bases in sphk2; 257 correct\namino acids from the start codon and 16 incorrect amino acids (lack the sphingosine-binding domain) Kawahara Lab ZDB-LAB-060907-1 Chr: 16 2019-09-17
ZDB-ALT-130715-2 ks1 cdh Unknown spontaneous Thorpe Lab ZDB-LAB-060223-1 Chr: 15 2019-09-17
ZDB-ALT-160922-12 kst10Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg3(Tru.Hoxa2-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-160922-13 2019-09-17
ZDB-ALT-160922-13 kst11Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg4(Tru.Hoxa2-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-160922-14 2019-09-17
ZDB-ALT-190118-2 kst12Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(Mmu.Meis2-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190118-2 2019-09-17
ZDB-ALT-190118-3 kst13Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg2(Mmu.Meis2-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-190118-3 2019-09-17
ZDB-ALT-150210-1 kst1Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(Mmu.Hoxb1:EGFP) ZDB-TGCONSTRCT-150210-1 2019-09-17
ZDB-ALT-150210-2 kst2Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(hoxa2b:EGFP) ZDB-TGCONSTRCT-150210-2 2019-09-17
ZDB-ALT-150210-3 kst3Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(Mmu.Hoxb3:EGFP) ZDB-TGCONSTRCT-150210-3 2019-09-17
ZDB-ALT-150210-4 kst4Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(Mmu.Hoxb4:EGFP) ZDB-TGCONSTRCT-150210-4 2019-09-17
ZDB-ALT-150210-5 kst5Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(Mmu.Epha4:EGFP) ZDB-TGCONSTRCT-150210-5 2019-09-17
ZDB-ALT-160922-8 kst6Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(Tru.Hoxa2a-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-160922-9 2019-09-17
ZDB-ALT-160922-9 kst7Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(Tru.Hoxa2b-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-160922-10 2019-09-17
ZDB-ALT-160922-10 kst8Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg(Tru.Hoxa2-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-160922-11 2019-09-17
ZDB-ALT-160922-11 kst9Tg Transgenic Insertion embryos treated with DNA Krumlauf Lab ZDB-LAB-970409-29 Unmapped Tg2(Tru.Hoxa2-Mmu.Fos:EGFP) ZDB-TGCONSTRCT-160922-12 2019-09-17
ZDB-ALT-161122-3 kt1002 Indel embryos treated with TALEN1-mespab Takada Lab ZDB-LAB-050728-1 Chr: 25 2019-09-17
ZDB-ALT-161122-2 kt1004 Indel embryos treated with TALEN1-mespba Takada Lab ZDB-LAB-050728-1 Chr: 7 2019-09-17
ZDB-ALT-161122-5 kt1006 Indel embryos treated with TALEN1-mespbb Takada Lab ZDB-LAB-050728-1 Chr: 25 2019-09-17
ZDB-ALT-161122-6 kt1009 Small Deletion embryos treated with TALEN1-mespbb Takada Lab ZDB-LAB-050728-1 Chr: 25 2019-09-17
ZDB-ALT-161122-1 kt1017 Indel embryos treated with TALEN1-mespaa Takada Lab ZDB-LAB-050728-1 Chr: 7 2019-09-17
ZDB-ALT-161122-4 kt1030 Indel embryos treated with TALEN2-mespab Takada Lab ZDB-LAB-050728-1 Chr: 25 2019-09-17
ZDB-ALT-161122-7 kt1032 Small Deletion embryos treated with TALEN1-ripply1 Takada Lab ZDB-LAB-050728-1 Chr: 21 2019-09-17
ZDB-ALT-161122-8 kt1034 Small Deletion embryos treated with TALEN1-ripply2 Takada Lab ZDB-LAB-050728-1 Chr: 4 2019-09-17
ZDB-ALT-040106-2 kt119 Unknown adult males treated with ENU Kondoh ERATO Lab ZDB-LAB-030930-1 Unmapped 2019-09-17
ZDB-ALT-040128-2 kt19 Unknown Kondoh ERATO Lab ZDB-LAB-030930-1 Unmapped 2019-09-17
ZDB-ALT-161102-1 kt2001Tg Transgenic Insertion embryos treated with DNA Takada Lab ZDB-LAB-050728-1 Unmapped Tg(UAS:mespba) ZDB-TGCONSTRCT-161102-1 2019-09-17
ZDB-ALT-161102-2 kt2002Tg Transgenic Insertion embryos treated with DNA Takada Lab ZDB-LAB-050728-1 Unmapped TgBAC(tbx6:GAL4FF) ZDB-TGCONSTRCT-161102-2 2019-09-17
ZDB-ALT-161201-3 kt2003Tg Transgenic Insertion embryos treated with DNA Takada Lab ZDB-LAB-050728-1 Unmapped Tg(fli1a:KikGR) ZDB-TGCONSTRCT-161031-1 2019-09-17
ZDB-ALT-050713-2 kt259 Point Mutation adult males treated with ENU Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 9 2019-09-17
ZDB-ALT-050713-4 kt293 Small Deletion adult males treated with ENU Sequence analyisis of itga5 in kt293 revealed a deletion of four nucleotides that cosegregated with the mutant phenotype. (Koshida et al., 2005) Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 23 2019-09-17
ZDB-ALT-071019-6 kt338 Unknown Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 19 2019-09-17
ZDB-ALT-071019-7 kt378b Point Mutation adult males treated with ENU This allele is a point mutation in the splicing acceptor of the 1st intron. Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 8 2019-09-17
ZDB-ALT-071019-8 kt440 Unknown Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 15 2019-09-17
ZDB-ALT-050819-2 kt443 Unknown Kondoh ERATO Lab ZDB-LAB-030930-1 Unmapped 2019-09-17
ZDB-ALT-050713-8 kt451 Point Mutation adult males treated with ENU Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 23 2019-09-17
ZDB-ALT-040106-4 kt5 Unknown adult males treated with ENU Kondoh ERATO Lab ZDB-LAB-030930-1 Unmapped 2019-09-17
ZDB-ALT-071019-9 kt501a Unknown Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 19 2019-09-17
ZDB-ALT-040106-6 kt62 Unknown adult males treated with ENU Kondoh ERATO Lab ZDB-LAB-030930-1 Unmapped 2019-09-17
ZDB-ALT-071019-10 kt633 Unknown Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 19 2019-09-17
ZDB-ALT-071219-1 kt641 Point Mutation adult males treated with ENU Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 13 2019-09-17
ZDB-ALT-050713-6 kt664 Unknown adult males treated with ENU Kondoh ERATO Lab ZDB-LAB-030930-1 Chr: 23 2019-09-17
ZDB-ALT-180827-2 kts1Tg Transgenic Insertion embryos treated with DNA Wada Lab ZDB-LAB-170331-1 Unmapped Tg2(krt4:RFP) ZDB-TGCONSTRCT-180827-2 2019-09-17
ZDB-ALT-180827-3 kts2Tg Transgenic Insertion embryos treated with DNA Wada Lab ZDB-LAB-170331-1 Unmapped Tg(UAS:dnfzd3a-RFP) ZDB-TGCONSTRCT-180827-3 2019-09-17
ZDB-ALT-050926-4 ku1Tg ku1, Tg(hsp70:EGFP-cre), Tg(hsp70:EGFP-cre)ku1 Transgenic Insertion embryos treated with DNA Godwin Lab ZDB-LAB-040810-3 Unmapped Tg(hsp70l:EGFP-Cre) ZDB-TGCONSTRCT-070117-156 2019-09-17
ZDB-ALT-110804-2 ku20Tg Tg(3xmnx1:Gal4-VP16)ku20 Transgenic Insertion embryos treated with DNA Cellular and Developmental Neuroscience ZDB-LAB-110720-1 Unmapped Tg(3xmnx1:GAL4-VP16) ZDB-TGCONSTRCT-110803-1 2019-09-17
ZDB-ALT-090105-1 ky1Tg Tg(EcRpsL)ky1 Transgenic Insertion embryos treated with DNA Section of Experimental Pathology and Toxicology ZDB-LAB-970428-1 Unmapped Tg(Eco.RpsL) ZDB-TGCONSTRCT-090105-1 2019-09-17
ZDB-ALT-121115-1 kyu1Tg isi01, Tcf:mini-p, Tg(OTM:d2EGFP)kyu1 Transgenic Insertion embryos treated with DNA This line contains 4 copies of the transgene. It was out crossed to wild-type fish to obtain the single copy lines kyu2 and kyu3. Ishitani Lab ZDB-LAB-121114-2 Unmapped Tg(OTM:d2EGFP) ZDB-TGCONSTRCT-121115-1 2019-09-17
ZDB-ALT-121115-2 kyu2Tg isi04, Tg(OTM:d2EGFP)kyu2 Transgenic Insertion embryos treated with DNA Ishitani Lab ZDB-LAB-121114-2 Unmapped Tg(OTM:d2EGFP) ZDB-TGCONSTRCT-121115-1 2019-09-17
ZDB-ALT-121115-3 kyu3Tg isi05, Tg(OTM:d2EGFP)kyu3 Transgenic Insertion embryos treated with DNA Ishitani Lab ZDB-LAB-121114-2 Unmapped Tg(OTM:d2EGFP) ZDB-TGCONSTRCT-121115-1 2019-09-17
ZDB-ALT-190214-1 kyu4Tg isi02 Transgenic Insertion embryos treated with DNA Ishitani Lab ZDB-LAB-121114-2 Unmapped Tg(8xGBS:d2EGFP) ZDB-TGCONSTRCT-190214-1 2019-09-17
ZDB-ALT-180227-1 kz1 Small Deletion embryos treated with CRISPR1-lrrc15 Isao Kobayashi Lab ZDB-LAB-170118-1 Chr: 6 2019-09-17
ZDB-ALT-180227-2 kz2 Small Deletion embryos treated with CRISPR1-drl Isao Kobayashi Lab ZDB-LAB-170118-1 Chr: 5 2019-09-17
ZDB-ALT-180227-3 kz3 Insertion embryos treated with CRISPR1-abcg2a Isao Kobayashi Lab ZDB-LAB-170118-1 Chr: 23 2019-09-17
ZDB-ALT-050126-2 l01Tg l01, Tg(Th:GFP), Tg(Th:GFP)l01 Transgenic Insertion embryos treated with DNA Lei Li Lab ZDB-LAB-000330-1 Unmapped Tg(Rno.Th:GFP) ZDB-TGCONSTRCT-070117-22 2019-09-17
ZDB-ALT-050126-4 l02Tg l02, Tg(rho:shGFP), Tg(rho:shGFP)l02 Transgenic Insertion embryos treated with DNA Lei Li Lab ZDB-LAB-000330-1 Unmapped Tg(rho:shGFP) ZDB-TGCONSTRCT-070117-172 2019-09-17
ZDB-ALT-110503-2 l04Tg Tg(gnrh3:GFP)l04 Transgenic Insertion embryos treated with DNA Lei Li Lab ZDB-LAB-000330-1 Unmapped Tg(gnrh3:GFP) ZDB-TGCONSTRCT-110503-1 2019-09-17
ZDB-ALT-140123-32 l05 bcs Unknown adult males treated with ENU Lei Li Lab ZDB-LAB-000330-1 Unmapped 2019-09-17
ZDB-ALT-120130-595 la010000Tg This feature is representative of one or more unknown insertion sites. la010000 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-1 la010001Tg This feature is representative of one or more unknown insertion sites. la010001 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-152 la010002Tg This feature is representative of one or more unknown insertion sites. la010002 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-2 la010006Tg This feature is representative of one or more unknown insertion sites. la010006 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-503 la010007Tg This feature is representative of one or more unknown insertion sites. la010007 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-288 la010011Tg This feature is representative of one or more unknown insertion sites. la010011 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-3 la010012Tg This feature is representative of one or more unknown insertion sites. la010012 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-504 la010014Tg This feature is representative of one or more unknown insertion sites. la010014 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-596 la010015Tg This feature is representative of one or more unknown insertion sites. la010015 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-4 la010016Tg This feature is representative of one or more unknown insertion sites. la010016 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-2 la010017Tg This feature is representative of one or more unknown insertion sites. la010017 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-153 la010018Tg This feature is representative of one or more unknown insertion sites. la010018 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-289 la010020Tg This feature is representative of one or more unknown insertion sites. la010020 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-5 la010022Tg This feature is representative of one or more unknown insertion sites. la010022 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-154 la010024Tg This feature is representative of one or more unknown insertion sites. la010024 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-597 la010025Tg This feature is representative of one or more unknown insertion sites. la010025 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-6 la010026Tg This feature is representative of one or more unknown insertion sites. la010026 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-505 la010027Tg This feature is representative of one or more unknown insertion sites. la010027 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-290 la010029Tg This feature is representative of one or more unknown insertion sites. la010029 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-7 la010030Tg This feature is representative of one or more unknown insertion sites. la010030 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-506 la010031Tg This feature is representative of one or more unknown insertion sites. la010031 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-3 la010032Tg This feature is representative of one or more unknown insertion sites. la010032 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1888 la010033Tg This feature is representative of one or more unknown insertion sites. la010033 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-598 la010034Tg This feature is representative of one or more unknown insertion sites. la010034 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-4 la010036Tg This feature is representative of one or more unknown insertion sites. la010036 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-8 la010039Tg This feature is representative of one or more unknown insertion sites. la010039 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-507 la010040Tg This feature is representative of one or more unknown insertion sites. la010040 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-5 la010041Tg This feature is representative of one or more unknown insertion sites. la010041 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-6 la010042Tg This feature is representative of one or more unknown insertion sites. la010042 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-7 la010043Tg This feature is representative of one or more unknown insertion sites. la010043 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-8 la010044Tg This feature is representative of one or more unknown insertion sites. la010044 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-599 la010045Tg This feature is representative of one or more unknown insertion sites. la010045 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-9 la010047Tg This feature is representative of one or more unknown insertion sites. la010047 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-155 la010048Tg This feature is representative of one or more unknown insertion sites. la010048 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-291 la010049Tg This feature is representative of one or more unknown insertion sites. la010049 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-426 la010050Tg This feature is representative of one or more unknown insertion sites. la010050 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-508 la010051Tg This feature is representative of one or more unknown insertion sites. la010051 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-9 la010053Tg This feature is representative of one or more unknown insertion sites. la010053 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-292 la010054Tg This feature is representative of one or more unknown insertion sites. la010054 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-427 la010055Tg This feature is representative of one or more unknown insertion sites. la010055 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1889 la010056Tg This feature is representative of one or more unknown insertion sites. la010056 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-10 la010057Tg This feature is representative of one or more unknown insertion sites. la010057 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-156 la010058Tg This feature is representative of one or more unknown insertion sites. la010058 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-293 la010060Tg This feature is representative of one or more unknown insertion sites. la010060 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-428 la010062Tg This feature is representative of one or more unknown insertion sites. la010062 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-157 la010064Tg This feature is representative of one or more unknown insertion sites. la010064 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-600 la010065Tg This feature is representative of one or more unknown insertion sites. la010065 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-11 la010067Tg This feature is representative of one or more unknown insertion sites. la010067 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-429 la010068Tg This feature is representative of one or more unknown insertion sites. la010068 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Ambiguous Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-12 la010069Tg This feature is representative of one or more unknown insertion sites. la010069 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1890 la010071Tg This feature is representative of one or more unknown insertion sites. la010071 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-509 la010075Tg This feature is representative of one or more unknown insertion sites. la010075 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-13 la010076Tg This feature is representative of one or more unknown insertion sites. la010076 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-14 la010078Tg This feature is representative of one or more unknown insertion sites. la010078 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-15 la010080Tg This feature is representative of one or more unknown insertion sites. la010080 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-16 la010081Tg This feature is representative of one or more unknown insertion sites. la010081 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-601 la010083Tg This feature is representative of one or more unknown insertion sites. la010083 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-10 la010084Tg This feature is representative of one or more unknown insertion sites. la010084 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-158 la010085Tg This feature is representative of one or more unknown insertion sites. la010085 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-294 la010088Tg This feature is representative of one or more unknown insertion sites. la010088 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-430 la010089Tg This feature is representative of one or more unknown insertion sites. la010089 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-159 la010090Tg This feature is representative of one or more unknown insertion sites. la010090 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-295 la010091Tg This feature is representative of one or more unknown insertion sites. la010091 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-11 la010092Tg This feature is representative of one or more unknown insertion sites. la010092 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-160 la010093Tg This feature is representative of one or more unknown insertion sites. la010093 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-296 la010094Tg This feature is representative of one or more unknown insertion sites. la010094 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-12 la010095Tg This feature is representative of one or more unknown insertion sites. la010095 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-161 la010096Tg This feature is representative of one or more unknown insertion sites. la010096 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-297 la010097Tg This feature is representative of one or more unknown insertion sites. la010097 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-13 la010098Tg This feature is representative of one or more unknown insertion sites. la010098 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-17 la010099Tg This feature is representative of one or more unknown insertion sites. la010099 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 24 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-18 la010100Tg This feature is representative of one or more unknown insertion sites. la010100 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-510 la010101Tg This feature is representative of one or more unknown insertion sites. la010101 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-431 la010105Tg This feature is representative of one or more unknown insertion sites. la010105 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-19 la010106Tg This feature is representative of one or more unknown insertion sites. la010106 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-511 la010108Tg This feature is representative of one or more unknown insertion sites. la010108 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-298 la010109Tg This feature is representative of one or more unknown insertion sites. la010109 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-432 la010110Tg This feature is representative of one or more unknown insertion sites. la010110 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-162 la010111Tg This feature is representative of one or more unknown insertion sites. la010111 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1891 la010112Tg This feature is representative of one or more unknown insertion sites. la010112 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1892 la010113Tg This feature is representative of one or more unknown insertion sites. la010113 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-299 la010114Tg This feature is representative of one or more unknown insertion sites. la010114 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-20 la010115Tg This feature is representative of one or more unknown insertion sites. la010115 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-433 la010116Tg This feature is representative of one or more unknown insertion sites. la010116 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-163 la010117Tg This feature is representative of one or more unknown insertion sites. la010117 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-603 la010118Tg This feature is representative of one or more unknown insertion sites. la010118 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-14 la010119Tg This feature is representative of one or more unknown insertion sites. la010119 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-512 la010120Tg This feature is representative of one or more unknown insertion sites. la010120 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-300 la010122Tg This feature is representative of one or more unknown insertion sites. la010122 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-15 la010123Tg This feature is representative of one or more unknown insertion sites. la010123 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-164 la010124Tg This feature is representative of one or more unknown insertion sites. la010124 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-301 la010125Tg This feature is representative of one or more unknown insertion sites. la010125 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-16 la010126Tg This feature is representative of one or more unknown insertion sites. la010126 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1893 la010128Tg This feature is representative of one or more unknown insertion sites. la010128 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-21 la010129Tg This feature is representative of one or more unknown insertion sites. la010129 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-513 la010130Tg This feature is representative of one or more unknown insertion sites. la010130 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-302 la010131Tg This feature is representative of one or more unknown insertion sites. la010131 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-434 la010132Tg This feature is representative of one or more unknown insertion sites. la010132 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-165 la010133Tg This feature is representative of one or more unknown insertion sites. la010133 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-604 la010134Tg This feature is representative of one or more unknown insertion sites. la010134 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-17 la010135Tg This feature is representative of one or more unknown insertion sites. la010135 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-22 la010136Tg This feature is representative of one or more unknown insertion sites. la010136 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-23 la010137Tg This feature is representative of one or more unknown insertion sites. la010137 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 12 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-24 la010138Tg This feature is representative of one or more unknown insertion sites. la010138 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-514 la010139Tg This feature is representative of one or more unknown insertion sites. la010139 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-25 la010140Tg This feature is representative of one or more unknown insertion sites. la010140 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-26 la010142Tg This feature is representative of one or more unknown insertion sites. la010142 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-27 la010144Tg This feature is representative of one or more unknown insertion sites. la010144 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-28 la010145Tg This feature is representative of one or more unknown insertion sites. la010145 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-435 la010147Tg This feature is representative of one or more unknown insertion sites. la010147 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-166 la010148Tg This feature is representative of one or more unknown insertion sites. la010148 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-304 la010149Tg This feature is representative of one or more unknown insertion sites. la010149 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-18 la010150Tg This feature is representative of one or more unknown insertion sites. la010150 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-515 la010151Tg This feature is representative of one or more unknown insertion sites. la010151 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-605 la010152Tg This feature is representative of one or more unknown insertion sites. la010152 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-29 la010153Tg This feature is representative of one or more unknown insertion sites. la010153 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-19 la010154Tg This feature is representative of one or more unknown insertion sites. la010154 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 4 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-167 la010155Tg This feature is representative of one or more unknown insertion sites. la010155 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-30 la010156Tg This feature is representative of one or more unknown insertion sites. la010156 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-305 la010157Tg This feature is representative of one or more unknown insertion sites. la010157 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-436 la010158Tg This feature is representative of one or more unknown insertion sites. la010158 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-31 la010159Tg This feature is representative of one or more unknown insertion sites. la010159 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-168 la010160Tg This feature is representative of one or more unknown insertion sites. la010160 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 22 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-306 la010161Tg This feature is representative of one or more unknown insertion sites. la010161 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-437 la010162Tg This feature is representative of one or more unknown insertion sites. la010162 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-516 la010163Tg This feature is representative of one or more unknown insertion sites. la010163 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-307 la010164Tg This feature is representative of one or more unknown insertion sites. la010164 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-438 la010165Tg This feature is representative of one or more unknown insertion sites. la010165 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-517 la010166Tg This feature is representative of one or more unknown insertion sites. la010166 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-32 la010167Tg This feature is representative of one or more unknown insertion sites. la010167 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-606 la010168Tg This feature is representative of one or more unknown insertion sites. la010168 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-33 la010169Tg This feature is representative of one or more unknown insertion sites. la010169 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-20 la010170Tg This feature is representative of one or more unknown insertion sites. la010170 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-169 la010171Tg This feature is representative of one or more unknown insertion sites. la010171 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-308 la010172Tg This feature is representative of one or more unknown insertion sites. la010172 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1894 la010174Tg This feature is representative of one or more unknown insertion sites. la010174 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-21 la010175Tg This feature is representative of one or more unknown insertion sites. la010175 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-170 la010176Tg This feature is representative of one or more unknown insertion sites. la010176 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-34 la010178Tg This feature is representative of one or more unknown insertion sites. la010178 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-607 la010179Tg This feature is representative of one or more unknown insertion sites. la010179 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-22 la010180Tg This feature is representative of one or more unknown insertion sites. la010180 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-35 la010181Tg This feature is representative of one or more unknown insertion sites. la010181 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-171 la010182Tg This feature is representative of one or more unknown insertion sites. la010182 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1895 la010184Tg This feature is representative of one or more unknown insertion sites. la010184 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-36 la010185Tg This feature is representative of one or more unknown insertion sites. la010185 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1896 la010186Tg This feature is representative of one or more unknown insertion sites. la010186 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-37 la010187Tg This feature is representative of one or more unknown insertion sites. la010187 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 6 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-309 la010188Tg This feature is representative of one or more unknown insertion sites. la010188 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-439 la010189Tg This feature is representative of one or more unknown insertion sites. la010189 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-172 la010190Tg This feature is representative of one or more unknown insertion sites. la010190 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-310 la010192Tg This feature is representative of one or more unknown insertion sites. la010192 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 1 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-440 la010193Tg This feature is representative of one or more unknown insertion sites. la010193 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-518 la010195Tg This feature is representative of one or more unknown insertion sites. la010195 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-608 la010196Tg This feature is representative of one or more unknown insertion sites. la010196 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-441 la010200Tg This feature is representative of one or more unknown insertion sites. la010200 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-1897 la010201Tg This feature is representative of one or more unknown insertion sites. la010201 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-173 la010202Tg This feature is representative of one or more unknown insertion sites. la010202 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-311 la010203Tg This feature is representative of one or more unknown insertion sites. la010203 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-38 la010206Tg This feature is representative of one or more unknown insertion sites. la010206 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 18 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-23 la010208Tg This feature is representative of one or more unknown insertion sites. la010208 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-174 la010209Tg This feature is representative of one or more unknown insertion sites. la010209 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-312 la010210Tg This feature is representative of one or more unknown insertion sites. la010210 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-442 la010211Tg This feature is representative of one or more unknown insertion sites. la010211 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-519 la010212Tg This feature is representative of one or more unknown insertion sites. la010212 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-39 la010213Tg This feature is representative of one or more unknown insertion sites. la010213 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 14 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-40 la010214Tg This feature is representative of one or more unknown insertion sites. la010214 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 11 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-313 la010215Tg This feature is representative of one or more unknown insertion sites. la010215 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-41 la010216Tg This feature is representative of one or more unknown insertion sites. la010216 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-42 la010217Tg This feature is representative of one or more unknown insertion sites. la010217 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 9 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-43 la010218Tg This feature is representative of one or more unknown insertion sites. la010218 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 10 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-24 la010219Tg This feature is representative of one or more unknown insertion sites. la010219 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 15 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-520 la010220Tg This feature is representative of one or more unknown insertion sites. la010220 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-609 la010221Tg This feature is representative of one or more unknown insertion sites. la010221 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 7 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-44 la010222Tg This feature is representative of one or more unknown insertion sites. la010222 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-45 la010223Tg This feature is representative of one or more unknown insertion sites. la010223 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 3 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-25 la010224Tg This feature is representative of one or more unknown insertion sites. la010224 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-521 la010225Tg This feature is representative of one or more unknown insertion sites. la010225 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-610 la010226Tg This feature is representative of one or more unknown insertion sites. la010226 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 23 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-26 la010227Tg This feature is representative of one or more unknown insertion sites. la010227 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 8 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-46 la010230Tg This feature is representative of one or more unknown insertion sites. la010230 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 5 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-611 la010231Tg This feature is representative of one or more unknown insertion sites. la010231 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-47 la010232Tg This feature is representative of one or more unknown insertion sites. la010232 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 25 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-443 la010233Tg This feature is representative of one or more unknown insertion sites. la010233 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-175 la010234Tg This feature is representative of one or more unknown insertion sites. la010234 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 17 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-314 la010235Tg This feature is representative of one or more unknown insertion sites. la010235 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-444 la010237Tg This feature is representative of one or more unknown insertion sites. la010237 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 13 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-176 la010238Tg This feature is representative of one or more unknown insertion sites. la010238 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-612 la010239Tg This feature is representative of one or more unknown insertion sites. la010239 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-48 la010240Tg This feature is representative of one or more unknown insertion sites. la010240 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 16 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-27 la010241Tg This feature is representative of one or more unknown insertion sites. la010241 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 20 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-49 la010242Tg This feature is representative of one or more unknown insertion sites. la010242 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 19 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-130129-50 la010243Tg This feature is representative of one or more unknown insertion sites. la010243 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 2 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-523 la010245Tg This feature is representative of one or more unknown insertion sites. la010245 Transgenic Insertion embryos treated with DNA Burgess & Lin Lab ZDB-LAB-111117-3 Chr: 21 Tg(nLacz-GTvirus) ZDB-TGCONSTRCT-070117-175 2019-09-17
ZDB-ALT-120130-613 la010246Tg This feature is representative of one or more unknown insertion sites. la010246 Transgenic Insertion embryos trea