OBO ID: CHEBI:65307
Term Name: corticotropin-releasing hormone (ovine) Search Ontology:
Synonyms:
  • Corticotropin-releasing factor (sheep hypothalamus)
  • Corticotropin-releasing factor (sheep)
  • L-seryl-L-glutaminyl-L-alpha-glutamyl-L-prolyl-L-prolyl-L-isoleucyl-L-seryl-L-leucyl-L-alpha-aspartyl-L-leucyl-L-valyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-arginyl-L-alpha-glutamyl-L-valyl-L-leucyl-L-alpha-glutamyl-L-methionyl-L-threonyl-L-lysyl-
  • Ovine ACTH releasing factor
  • Ovine corticotropin-releasing factor
  • Ovine CRF 41
  • Ovine CRH
  • Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Val-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
  • Sheep corticotropin-releasing factor (1-41)
  • sheep corticotropin-releasing hormone
  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Definition: A corticotropin-releasing hormone from sheep composed of Ser, Gln, Glu, Pro, Pro, Ile, Ser, Leu, Asp, Leu, Val, Phe, His, Leu, Leu, Arg, Glu, Val, Leu, Glu, Met, Thr, Lys, Ala, Asp, Gln, Leu, Ala, Gln, Gln, Ala, His, Ser, Asn, Arg, Lys, Leu, Leu, Asp, Ile and Ala-NH2 residues joined in sequence.
References:
Ontology: Chebi
PHENOTYPE No data available