Term Name: peptide YY
Synonyms: peptide tyrosine tyrosine, PYY (3-36), PYY 3-36, PYY3-36, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2, YPIKPEAPGEDASPEELNYYASLRHYLNLVTRQRY-NH2
Definition: A 36-membered human gut polypeptide consisting of Tyr, Pro, Ile, Lys, Pro, Glu, Ala, Pro, Gly, Glu, Asp, Ala, Ser, Pro, Glu, Glu, Leu, Asn, Arg, Tyr, Tyr, Ala, Ser, Leu, Arg, His, Tyr, Leu, Asn, Leu, Val, Thr, Arg, Gln, Arg and Tyr-NH2 residues joined in sequence.
Ontology: Chebi [CHEBI:80330]

Relationships
is a type of: peptide hormone peptidyl amide polypeptide
has_role: appetite depressant human metabolite neuropeptide Y2 receptor agonist