Term Name: | kisspeptin-54 |
---|---|
Synonyms: | Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2, GYSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKALPAYNWNSFGLRF-NH2, Kisspeptin, Metastin |
Definition: | A 65-membered peptide hormone consisting of Gly, Thr, Ser, Leu, Ser, Pro, Pro, Pro, Glu, Ser, Ser, Gly, Ser, Arg, Gln, Gln, Pro, Gly, Leu, Ser, Ala, Pro, His, Ser, Arg, Gln, Ile, Pro, Ala, Pro, Gln, Gly, Ala, Val, Leu, Val, Gln, Arg, Glu, Lys, Asp, Leu, Pro, Asn, Tyr, Asn, Trp, Asn, Ser, Phe, Gly, Leu, Arg and Phe-NH2 residues joined in sequence. |
Ontology: | Chebi [CHEBI:80304] |